La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Neuraminidase or N Protein Hemagglutinin or H Protein Fatty or Lipid Envelope Matrix Protein embrane Protein Coat or Nucleoprotein RNA Ortomyxovirus Virus.

Presentazioni simili


Presentazione sul tema: "Neuraminidase or N Protein Hemagglutinin or H Protein Fatty or Lipid Envelope Matrix Protein embrane Protein Coat or Nucleoprotein RNA Ortomyxovirus Virus."— Transcript della presentazione:

1 Neuraminidase or N Protein Hemagglutinin or H Protein Fatty or Lipid Envelope Matrix Protein embrane Protein Coat or Nucleoprotein RNA Ortomyxovirus Virus Influenzale

2 “INFLUENZA” influenza “vera” –virus dell’influenza malattia dell’apparato respiratorio associata a sintomi sistemici e causata da una varietà di altri microrganismi spesso chiamata “influenza”

3 ORTHOMYXOVIRUS M1 protein nucleocapside elicoidale (RNA e proteina NP) HA - emogglutinina complesso della polimerasi lipid bilayer membrane NA - neuraminidasi TIPO A, B, C : NP, M1 protein SOTTO-TIPO: HA or NA protein

4

5 CICLO REPLICATIVO mRNA vRNA (-) cRNA (+) Traduzione Processamento post- trascrizionale packagin NUCLEO Fusione e uncoating ENDOCITOSI ASSORBIMENTO

6 Principali antigeni virali Gli antigeni INTERNI (proteine M1 e NP) sono le proteine tipo-specifiche (A, B, C) Gli antigeni ESTERNI (HA e NA) sono gli antigeni sottotipo- e ceppo-specifici.

7 Nomenclatura Nelle proteine esterne (HA e NA) si manifestano le principali differenze fra i vari ceppi influenzali Sono quindi utilizzate per indicare un PARTICOLARE CEPPO DI INFLUENZA, secondo la caratteristica denominazione “HxNy” Sono le proteine che stimolano il nostro sistema immunitarioAb specifici protezione

8 IL VIRUS INFLUENZALE NEL TRATTO RESPIRATORIO Il virus influenzale si attacca (tramite l’HA ) alle cellule epiteliali del tratto respiratorio Il virus replica all’interno delle cellule La neuraminidasi virale consente il rilascio dei virioni neoformati nella vie aeree

9 COME SI TRASMETTE? Flusso d’aria Clearance mucociliare Linfonodi Il virus viene trasmesso tramite goccioline di saliva starnutendo, tossendo o semplicemente parlando La trasmissione è facilitata dal contatto stretto È altamente contagioso e trasmissibile I soggetti infetti sono contagiosi da pochi giorni prima e per i 5-7 giorni successivi alla comparsa dei sintomi Turbinati nasali Esofago Bronchi Bronchioli Trachea

10 MANIFESTAZIONI CLINICHE Il periodo di incubazione può durare dalle 24 ore ai 5/6 giorni. L’inizio della malattia è improvviso, con comparsa di febbre, brividi, mal di testa, gola secca, mialgia, malessere inappetenza e mal di gola. Il sintomo più rilevante è la febbre, che in assenza di trattamento antipiretico si innalza bruscamente nel corso di ore fino ai 41°C. Lo spettro delle manifestazioni cliniche varia notevolmente per gravità, da manifestazioni asintomatiche a complicazioni minori quali rinite e/o faringite fino alla polmonite virale con esito potenzialmente fatale

11 COMPLICAZIONI DELL’INFLUENZA Respiratorie Polmonite virale Polmonite batterica –da stafilococco –da streptococco Non-respiratorie l Miosite l Miocardite, pericardite l Mioglobinuria l depressione midollare l CNS l sindrome di Guillain-Barré l mielite trasversa l sindrome di Reye syndrome l Encefalite

12 URTI-otite media -sinusite LRTI-esacerbazione di asma/broncopatia -croup (un'ostruzione laringea sottoglottica), bronchiolite -polmonite virale primaria (rara*) -polmonite batterica secondaria * 5-10% delle polmoniti come complicanze dell’influenza INFLUENZA: LE COMPLICAZIONI RESPIRATORIE

13 INFLUENZA AL DI FUORI DEL TRATTO RESPIRATORIO ? dati disponibili su modelli animali Influenza come causa riconosciuta di miocardite nei cavalli Dati molto limitati sull’uomo La PCR potrà aiutare a riconoscere la presenza di virus influenzale al di fuori del tratto respiratorio

14 PREVALENZA DEI SINTOMI Tosse Malessere Sensazione di febbre Esordio improvviso Brividi Cefalea Anoressia Congestione nasale Mialgia Mal di gola Catarro Vertigini Abbassamento di voce Dolore retrosternale Vomito Diarrea Dolore addominale Febbre >37.8  C Percentuale dei casi Nicholson, 1998

15 CARATTERISTICHE CLINICHE DELL’INFEZIONE INFLUENZALE giorni dopo l’insorgenza dei sintomi congestione nasale / secrezione mal di gola dolori muscolari mal di testa tosse anoressia malessere infettività/ isolamento virale titolo anticorpale serico < 4 8 (dal 6 o al 21 o giorno insorgenza dei sintomi temperatura orale (*C)

16 Titolo virale nell’aspirato nasofaringeo (TCID 50 /ML) Titolo anticorpale (Reciprocal Geom. Mean) Giorni post- infezione IFN nell’aspirato nasofaringeo (U/ml) Sintomi influenzali ANTICORPI NEUTRALIZZANTI (AN) Ab anti-neuroaminidasi nel siero Ab neutralizzanti nel siero Virus Interferon

17 Correlazione tra risposta febbrile e titolo virale febbre LOG 10 titolo virale massimo nell’aspirato nasofaringeo (RMK TCID 50 /ml)

18 PRODUZIONE DI CITOCHINE DURANTE L’INFEZIONE DA INFLUENZA A ACQUISITA NATURALMENTE Concentrazione media di citochine nel lavaggio nasale (pg/ml) Hayden et al, 1998

19 DIAGNOSI DI INFLUENZA Riconoscimento dell’antigene Isolamento virale Sierologia (RT-PCR) lavaggio/tampone nasale aspirato nasofaringeo tampone faringeo, saliva test di inibizione dell’emagglutinazione fissazione del complemento } La disponibilità di dati epidemiologici provenienti da un sistema locale di sorveglianza migliora le possibilità di una diagnosi clinica attendibile

20 EPIDEMIE STAGIONALI Ogni anno nel periodo invernale si presentano epidemie influenzali Ogni anno le popolazioni a rischio devono essere vaccinate Ogni anni si presenta un NUOVO CEPPO influenzale in grado di causare EPIDEMIE

21 PANDEMIE Dall’inizio del ‘900 ad oggi si sono verificate 3 grandi pandemie influenzali con elevata mortalità Spagnola 500,000 USA 20,000,000 mondiale Asiatica 70,000 USA ,000 USA Hong Kong

22 Come e perché si originano i ceppi epidemici? Come e perché si originano i ceppi pandemici?

23 VARIAZIONE ANTIGENE Il virus influenzale A è soggetto a 2 forme distinte di variazioni che riguardano le sue proteine superficiali: - “antigenic drift” (“drift” antigenico): riflette cambiamenti minori sia dell’HA che della NA, o di entrambe - “major antigenic shift” (cambiamento maggiore): avviene raramente e riflette la comparsa di ceppi virali con proteine di superficie solo lontanamente correlati a quelli dei ceppi precedenti. Generalmente riguarda l’HA

24 Variazioni antigeniche MINORI (“drift”) derivano da MUTAZIONI nei geni dell’HA e della NA Antigenic drift (1)

25 Antigenic drift (2) HA e NA accumulano mutazioni –virus a RNA la risposta immunitaria non garantisce una protezione completa epidemie limitate

26 Cambiamenti antigenici MAGGIORI (“shift”) sono molto diversi, con ampia variazione nella sequenza amminoacidica Antigenic shift

27 Genoma Il virus influenzale presenta un’organizzazione del materiale genetico molto caratteristica Il virus dell’influenza ha un genoma costituito da molecole di RNA A differenza di altri virus questo e’ suddiviso in vari SEGMENTATI –8 segmenti diversi codificano proteine diverse –Tutti e gli 8 frammenti sono necessari perché la particella sia infettiva

28 Come avviene l’antigenic shift Human virusNon-human virus Reassortant virus Virus A Virus B Nuovo virus

29 Antigenic shift (2) Lo shift si verifica quando 2 virus con 2 HA diverse infettano la stessa cellula (A e B) Il virus che viene prodotto può essere identico ad A eccetto per la sua HA che deriva da B

30 INFLUENZA A, B o C Virus influenzali A, infettano uomo e numerose specie animali (UCCELLI!) Virus influenzali B e C sono virus UMANI, non isolati in uccelli (C è isolato da maiali e cani) Esistono 3 tipi di virus influenzali: A, B, C

31 SOLO L’INFLUENZA DI TIPO A PUO’ CAUSARE PANDEMIE

32 Come e perché si originano i ceppi epidemici? Come e perché si originano i ceppi pandemici?

33 VARIAZIONE ANTIGENE Il virus influenzale A è soggetto a 2 forme distinte di variazioni che riguardano le sue proteine superficiali: - “antigenic drift” (“drift” antigenico): riflette cambiamenti minori sia dell’HA che della NA, o di entrambe - “major antigenic shift” (cambiamento maggiore): avviene raramente e riflette la comparsa di ceppi virali con proteine di superficie solo lontanamente correlati a quelli dei ceppi precedenti. Generalmente riguarda l’HA

34 Variazioni antigeniche MINORI (“drift”) derivano da MUTAZIONI nei geni dell’HA e della NA Antigenic drift (1)

35 Antigenic drift (2) HA e NA accumulano mutazioni –virus a RNA la risposta immunitaria non garantisce una protezione completa epidemie limitate

36 Cambiamenti antigenici MAGGIORI (“shift”) sono molto diversi, con ampia variazione nella sequenza amminoacidica Antigenic shift

37 Genoma Il virus influenzale presenta un’organizzazione del materiale genetico molto caratteristica Il virus dell’influenza ha un genoma costituito da molecole di RNA A differenza di altri virus questo e’ suddiviso in vari SEGMENTATI –8 segmenti diversi codificano proteine diverse –Tutti e gli 8 frammenti sono necessari perché la particella sia infettiva

38 Come avviene l’antigenic shift Human virusNon-human virus Reassortant virus Virus A Virus B Nuovo virus

39 Antigenic shift (2) Lo shift si verifica quando 2 virus con 2 HA diverse infettano la stessa cellula (A e B) Il virus che viene prodotto può essere identico ad A eccetto per la sua HA che deriva da B

40 Diversità delle HA In natura sono note ben 16 HA diverse e 9 NA diverse Fino al 1997 nell’uomo hanno circolato solo la HA1, HA2 e la HA3 I 3 ceppi pandemici del 1918, 1957, 1968, rispettivamente H1N1, H2N2, H3N2 sono i ceppi ancora in circolazione

41 “Ribbon diagram” di alcune delle 16 HA

42 Trimeri di H1, H3, H7 e H9 Diverso orientamento del dominio di legame al recettore in 4 divese HA

43 Dove sono le rimanenti 13 HA ? I 16 tipi di HA e i 9 tipi di NA sono TUTTI presenti negli uccelli acquatici e selvatici Questi sono il SERBATOIO naturale di TUTTI i virus influenzali Coevoluzione VIRUS-OSPITE

44 Gli uccelli acquatici sono la fonte di TUTTI i ceppi influenzali Tutte le 16 HA e le 9 NA

45 Influenza aviaria Influenza A Gli uccelli selvatici funzionano da serbatoio Gli uomini normalmente non vengono infettati direttamente Gli uccelli domestici sono suscettibili d’infezione –HPAI –LPAI

46 Influenza aviaria

47 Proprietà dei virus dell’influenza aviaria –Highly Pathogenic Avian Influenza (HPAI) causano infezioni sistemiche LETALI (gli uccelli muoiono nel giro di 1 settimana) –Low Pathogenic Avian Influenza (LPAI) causano infezioni blande

48 Suscettibilità Molte specie di uccelli selvatici e domestici sono SUSCETTIBILI all’infezione Virus che sono altamente patogeni in una specie possono non esserlo in un’altra Fra le specie domestiche polli e tacchini sono più suscettibili ai ceppi HPAI I fattori dell’ospite che rendono un virus HPAI non sono noti Sono noti i fattori virali (caratteristiche dell’HA)

49 Trasmissione I virus dell’influenza aviaria replicano non solo a livello dell’apparato respiratorio, ma anche a livello INTESTINALE Sono trasmessi attraverso la via ORO-FECALE Sono presenti nelle feci degli uccelli Questo vale anche per le infezioni asintomatiche

50 IN NATURA: il riassortimento di segmenti genici dopo la co- infezione di una cellula da parte di un virus influenzale UMANO e di uno ANIMALE è responsabile della comparsa di nuovi ceppi pandemici TRASMISSIONE VIRALE INTERSPECIE 2 teorie principali, entrambe dimostrate PASSAGGIO DA UCCELLO DOMESTICO A UOMO PASSAGGIO ATTRAVERSO UN OSPITE INTERMEDIO (IL MAIALE)

51 Riassortimento nell’uomo Migratory water birds 1918 H1N1, Tautenberg JK et al, Nature, October 2005

52 Migratory water birds Riassortimento nel maiale 1957 H2N2, 1968 H3N2

53 Ceppi pandemici TUTTI i ceppi pandemici fino ad ora analizzati (H1N1, H2N2, H3N2) presentano un’HA di origine AVIARIA Inoltre, l’HA presentava una serie di caratteristiche che la accomunavano alla corrispondente HA di ceppi HPAI

54 Determinanti di paotogenicità nei virus dell’influenza aviaria Emoagglutinina (HA)

55 Meccanismo d’azione dell’HA 1. L’HA (che è una proteina TRIMERICA) media il legamie del virus ai recettori cellulari che contengono ACIDO SIALICO. Dopo il legami il virus è internalizzato per endocitosi 2. L’ambiente acido dell’endosoma provoca delle variazioni conformazioniali nel trimero di HA, mediando la fusione fra envelope virale e la membrana degli endosomi, che consente il rilascio della ribonucleoproteina virale al citoplasma

56 L’acido sialico Zucchero a 9 atomi di C, derivato dalla reazione di acido fosfenolpiruvico e N-acetil mannosammina Si ritrova in Gangliosidi e Glicolipidi della membrana cellulare Un composto molto simile è l’etere etilico dell’N-acetil glucosammina ( ACIDO MURAMICO)  2,3  2,6

57 Riconoscimento del recettore Le HA dei virus aviari riconoscono preferenzialmente i recettori contenenti residui di acido sialico legati al galattosio mediante un legame 2,3 (NeuAc2,3Gal) Le HA dei virus umani riconoscono preferenzialmente i recettori contenenti residui di acido sialico legati al galattosio mediante un legame 2,6 (NeuAc2,6Gal)

58 Riconoscimento del recettore Attivazione proteolitica HA e patogenicità

59 Riconoscimento del recettore I virus aviari riconoscono preferenzialmente i recettori contenenti residui di acido sialico legati al galattosio mediante un legame 2,3 (NeuAc2,3Gal) I virus umani riconoscono preferenzialmente i recettori contenenti residui di acido sialico legati al galattosio mediante un legame 2,6 (NeuAc2,6Gal) Residui aa COINVOLTI nel legame sono DIVERSI

60 Complesso fra recettore “umano” e HA di un virus influenzale umano Complesso fra recettore “aviario” e HA di un virus influenzale “aviario”

61 Attivazione proteolitica Oltre al riconoscimento del recettore, l’attivazione proteolitica è essenziale per l’infettività e la disseminazione dell’infezione La molecola di HA subisce un taglio post-traduzionale in due subunità HA1 e HA2 dalle proteasi dell’ospite il dominio fusogenico all’ N-termine dell’HA2 media la fusione tra l’envelope virale e la membrana endosomiale

62

63 Ruolo dell’attivazione proteolitica nella patogenicità L’Ha dei virus LPAI è tagliata da proteasi specifiche localizzate nel tratto respiratorio e intestinaleinfezioni localizzate e leggere L’HA dei virus HPAI presenta una serie di aa basici a livello del sito di taglio (RERRRKKR), che sono brsaglio di proteasi presenti in numerosi organi infezioni disseminate e letali L’attivazione proteolica dell’HA è uno dei principali determinanti del tropismo tissutale dei virus dell’influenza aviaria Differenze nella distribuzione tissutale delle proteasi e la diversa suscettibilità dell’HA a questi enzimi può determinare l’outcome dell’infezione.

64 CEPPI PANDEMICI Un ceppo pandemico si genera quando il virus con la nuova HA è in grado di passare da uomo a uomo Serie di alterazioni che consentono al virus di adattarsi alle cellule umane I recettori cellulari per i virus umani e aviari sono DIVERSI! Il maiale contiente nelle cellule della sua trachea entrambe i recettori ( NeuAc2,6Gal; NeuAc2,3Gal) perfetto serbatoio il riassortimento

65 Adattamento dell’HA aviaria al recettore umano Durante l’adattamento al nuovo ospite il virus cambia in alcuni residui aa che rendono la proteina aviaria adatta a riconoscere il recettore umano 138A 190E 194L 225G 226Q 228G

66

67 Evoluzione di una molecola di HA (H3)

68 Trimero dell’HA An expanded view of the F subdomain indicating differences between H1 and H5 subtypes of HA Punti di contatto fra recettore e HA HA del Virus della Spagnola

69 Imparando dalle passate pandemie Sia H2 che H3 presentavano le sostituzioni: 226Q L and 228G S. 226Q L appare essere la più critica H1 mostrava mutazioni alle posizioni 138, 190, 194 and 225 H5N1 isolato nel 1997 NON presentava alcuna di queste mutazioni

70 Trasmissione diretta all’uomo La difficoltà dei ceppi di influenza aviaria di infettare le cellule umane veniva considerata una barriera al salto di specie Tuttavia, dal 1997 una serie di virus aviari, a partire dal ceppo H5N1 si sono trasmessi DIRETTAMENTE dagli uccelli all’uomo Anche H1N1 (ceppo pandemico della Spagnola) sembra essere un virus aviario che ha saltato direttamente la specie

71 Migratory water birds Domestic birds Hong Kong 1997, H5N1 HK, China 1999, H9N2 Netherlands 2003, H7N7 Hong Kong 2003, H5N1 Viet Nam and Thailand, 2004 H5N1 Influenza aviari dagli uccelli all’uomo

72 Influenza aviaria nell’uomo 1997: Hong Kong –A(H5N1) infected chickens and humans –18 hospitalized, 6 died –1.5 million chickens culled Direct bird to human transmission Person-to-person transmission noted, rare (??) –Requires reassortment or adaptation

73 Avian Influenza 1999: Hong Kong –A(H9N2) 2003: Netherlands –A(H7N7) 2003: Hong Kong / China –A(H9N2) : Thailand, Vietnam –A(H5N1) –22 of 33 cases died

74 H7N7 H7N7, Netherlands, 2003: The Netherlands reported outbreaks of influenza A (H7N7) in poultry on several farms. Later, infections were reported among pigs and humans. In total, 89 people were confirmed to have H7N7 influenza virus infection associated with this poultry outbreak. These cases occurred mostly among poultry workers. H7N7-associated illness included 78 cases of conjunctivitis (eye infections) only; 5 cases of conjunctivitis and influenza-like illnesses with cough, fever, and muscle aches; 2 cases of influenza-like illness only; and 4 cases that were classified as “other.” There was one death among the 89 total cases. It occurred in a veterinarian who visited one of the affected farms and developed acute respiratory distress syndrome and complications related to H7N7 infection. The majority of these cases occurred as a result of direct contact with infected poultry; however, Dutch authorities reported three possible instances of transmission from poultry workers to family members. Since then, no other instances of H7N7 infection among humans have been reported.

75 11 giugno 2009: è pandemia 11 giugno 2009: l’OMS porta a livello 6

76 Viene descritto un nuovo sottotipo virale A/H1N1 che si diffonde da uomo a uomo Il sequenziamento dei primi isolati rivela che questo virus contiene segmenti genomici provenienti da 4 diversi virus influenzali: North American swine North American avian North American human Eurasian swine H1N1v Marzo 2009: i fatti

77 H1N1 nei suini: un po’ di storia 1930: H1N1 viene isolato per la prima volta nei suini stretta correlazione con H1N1 “umano” del anni ’90: H1N1 continua a circolare nei suini rimanendo relativamente stabile dal punto di vista antigenico

78 H1N1 nei suini: un po’ di storia 1998 (Nord America): si verifica un evento di TRIPLO riassortimento: H1N1 suino + H3N2 umano + ceppo americano di virus dell’influenza aviaria (sottotipo non conosciuto) Triplo riassortante H3N2 (rH3N2) nella popolazione dei suini del Nord America Ulteriore riassortimento con il ceppo H1N1 suino “classico” Tripli riassortanti suini H1N1 e H1N2 (recentemente isolati anche in Asia)

79 H1N1 nell’uomo: un po’ di storia : H1N1 circola nella popolazione umana (comparsa di H2N2) –“antigenic drift” sostanziale 1977: H1N1 riemerge nella popolazione umana : continua RAPIDA evoluzione del virus

80 Considerazioni Gap significativo tra l’HA di H1N1 circolante nei suini e nell’uomo Suino come reservoir di virus H1 con potenziale pandemico Occasionali isolamenti di virus dell’influenza suina dall’uomo Trasmissione uomo-uomo sempre risultata SPORADICA

81 H1N1v: caratteristiche Il virus passato all’uomo a Marzo del 2009 contiene una combinazione di segmenti genici mai precedentemente descritta I segmenti genici NA e M derivano dal lineage Euroasiatico dei virus suini (originariamente aviari) I segmenti HA, NP, e NS provengono la lineage classico dei virus suini (originariamente aviari) I segmenti PB2 e PA derivano dal lineage dei virus triplo riassortanti suini Il segmento PB1 deriva anch’esso dai triplo riassortanti, ma ha origine umana (originariamente virus aviaria)

82 L’ origine di H1N1v Da Garten RJ and al., Science 10 July 2009: Vol no. 5937, pp

83 Quali eventi di riassortimento abbiano portato alla genesi dell’attuale H1N1v e dove sia avvenuto tale riassortimento è al momento ancora da chiarire

84

85 Prevenzione

86 Chemotherapy Rimantadine and amantadine block virus entry across the endosome and also interfere with virus release. They are good prophylactic agents for influenza A, but there are some problems in taking them on a long term basis. They may be given as protective agents during an outbreak, especially to those at severe risk and key personnel. They may also be given at the time of vaccination for a few weeks, until the humoral response has time to develop. Two neuraminidase inhibitors have recently been approved by the FDA (zanamivir [Relenza] and oseltamivir). They are active against influenza A and influenza B. These drugs can reduce the duration of uncomplicated influenza (by approximately 1day). Oseltamavir is approved for prophylaxis as well as treatment. At the moment, Zanamivir is only approved for treatment but trials indicate it is probably as effective as oseltamivir in prophylaxis. As yet there are no clear data on the ability of any of the these drugs to reduce serious complications when used to treat influenza (as contrasted with when they are used prophylactically)..

87 Amantadine, Rimantadine Uncoating of the influenza virus occurs in low pH endosome or lysosomes, as the result of a pH-dependent fusogen Amantadine, Rimantadine are lysosomotropic. They were originally thought to stop acidification of the endocytic vesicles but it is now thought that they may act on maturation of virus in trans-Golgi network which is also acidic These drugs act on maturation of influenza HA glycoprotein so that progeny virus is poorly infective. These drugs good for oral prophylaxis against influenza A (but not influenza B). They are a good alternative to vaccine in immunocompromised patients and the elderly. Other than this, they are not used much in western countries.

88 Zanamivir e Tamiflu The neuraminidase (sialidase) has several functions. It allows the virus to move through mucous secretions in the respiratory tract so that it may infect new cells. Since sialic acid is the influenza receptor, it is necessary to remove sialic acid from the surface of the infected cell and of the virus so that viral particles may escape. The neuraminidase is therefore very important for the spread of the virus from cell to cell. Zanamivir (Relenza) is a potent inhibitor of the viral neuraminidase of types A and B influenza viruses. The design of Zanamivir is based on the three-dimensional structure of the neuraminidase. Treatment of community-acquired type A and B influenza with Zanamivir shortens the duration of major symptoms by about one day in the study group as a whole and about three days in the sicker patients if the drug is started early. Another neuraminidase inhibitor, Tamiflu (generically called oseltamivir), a carbocyclic sialic acid analogue can be given orally.

89 Resistenza ai farmaci Tutti gli H1N1v presentano resistenza agli adamantani (S31N in M2) Sono stati descritti solo alcuni ceppi di H1N1v resistenti all’osaltamivir (mutazioni a livello della NA, H275Y e I223V ) Tre ceppi resistenti sono stati identificati in Italia (uno a Padova)

90 Con interventi Scopi della riduzione a livello comunitario della trasmissione dell’influenza — mitigazione Ritardare e appiattire il picco epidemico Ridurre il picco del carico sul sistema sanitario e il pericolo Ridurre sensibilmente il numero totale dei casi Guadagnare tempo Casi giornalieri Giorni dal primo caso Senza interventi Based on an original graph developed by the US CDC, Atlanta

91 Perché vaccinarsi contro il virus influenzale Per proteggersi se stessi dalla malattia e dalle sue complicanze, riducendo i costi sociali connessi Per proteggere la collettività, riducendo le fonti di infezione e quindi la circolazione interumana del virus

92 Campagna per la vaccinazione nei confronti dei virus influenzali stagionali ( )

93 Composizione del vaccino antinfluenzale A/Brisbane/59/2007 (H1N1) (presente anche nel vaccino 2008/09) A/Brisbane/10/2007 (H3N2) (presente anche nel vaccino 2008/09) B/Brisbane/60/2008 (nuova variante)

94 Effetti collaterali alla vaccinazione I vaccini antinfluenzali contengono solo VIRUS INATTIVATI o parti di questi, pertanto NON causano infezione da virus influenzale Gli effetti collaterali consistono generalmente in reazioni locali (dolore, eritema, gonfiore nel sito di iniezione) che si risolvono in pochi giorni Le reazioni sistemiche (malessere generale, febbre, mialgie) sono più rare e durano 1-2 giorni Sono segnalate reazioni allergiche

95 L’EMEA (Agenzia europea controllo farmaci) ha autorizzato l’utilizzo di due vaccini contro l’influenza A/H1N1 nuova variante (pandemica) FOCETRIA (Novartis) PANDEMRIX (GlaxoSmithKline) Entrambi i vaccini contengono l’Ag HA ottenuta su uova embrionate di pollo e sono ADIUVATI

96

97 Programma di vaccinazione contro H1N1v I fase –Personale sanitario –Personale dei servizi essenziali –Donne nel II e III trimestre di gravidanza –Persone a rischio sanitario tra i 6 mesi e i 65 anni II fase –Tutte le persone comprese tra i 6 mesi e i 27 anni di età Copertura del 40% della popolazione italiana

98 The seed virus was grown in Madin–Darby Canine Kidney (MDCK) cell culture by means of standard processes similar to those used for the development of Optaflu vaccines against interpandemic influenza. The vaccine was formulated and produced by Novartis (Marburg, Germany) as an inactivated surface- antigen H1N1 vaccine, with MF59 adjuvant, and supplied in 0.5-ml prefilled single-dose syringes. Each MF59-adjuvanted vaccine contained 7.5 μg of H1 hemagglutinin, 9.75 mg of the squalene MF59, mg of polysorbate 80, and mg of sorbitan trioleate in buffer.

99

100 H5N1 virus In May 1997, an H5N1 virus (A/Hong Kong/156/97) was isolated from a 3-year-old boy in Hong Kong, who later died of extensive influenza pneumonia complicated by REYE SYNDROME By the end of 1997, a total of 18 people had been infected by this virus, six of whom died The clinical features of infection included onset of fever and upper- respiratory-tract infection, typical of classical influenza. Some patients had severe complications, mainly pneumonia, gastrointestinal manifestations, elevated liver enzymes and renal failure Epidemiological studies suggested direct transmission of the virus from birds and serological evidence of human-to-human transmission was limited to a few cases, indicating that the virus had not become fully adapted to its human host

101 H5N1 virus The human H5N1 isolates were not reassortants like the 1957 and 1968 pandemic strains All of the viral genes originated from a Eurasian avian virus The gene that encodes HA was derived from a H5N1 virus first isolated from a goose that died in Guangdong Province, China (A/goose/Guangdong/1/96) From 1997 through 2001, H5N1 viruses with an HA of the same genetic lineage continued to circulate in birds in southeastern China In 2002, another H5N1 virus showing ANTIGENIC DRIFT emerged in Hong Kong and was highly pathogenic in ducks and other aquatic birds, a property rarely associated with HPAI viruses In early 2003, an H5N1 virus infected a family in Hong Kong — the father and son developed severe respiratory illness and the father died. The daughter also died

102 Outbreak of H5N1 influenza The most devastating outbreak of influenza associated with H5N1 HPAI viruses occurred in 2003−2004 in Asian countries Although not officially reported, such viruses first appeared in July 2003 in poultry in Vietnam, Indonesia and Thailand Extensive phylogenetic analysis of the viruses isolated from poultry revealed multiple genetic reassortants representing multiple genotypes (A, B, C, D, E, V, W, X0−3, Y, Z and Z+), although each of the reassortant viruses possessed an HA similar to that of the HA from the A/goose/Guangdong/1/96 strain Similarly, nine different genotypes were identified in domestic-duck isolates in mainland China (proposed definition: A−I), which were not related to the genotypes that were described for poultry isolates.

103 Transmission to human Although outbreaks of HPAI viruses were confined to poultry (mainly chickens) in most countries, there was substantial transmission to humans, resulting in a total of 53 deaths in three countries The clinical presentations of fever, cough, diarrhoea, shortness of breath, rapid respiratory rate, lymphopaenia and abnormalities on chest radiography were similar to those noted during the 1997 H5N1 outbreak in Hong Kong The mortality rate in this outbreak was significantly higher than in the 1997 outbreak (54.6% versus 33.3%) There was no compelling evidence of human-to-human transmission in the more recent outbreak, with the exception of a few cases

104 Pigs Chickens Canal Vegetable plots Avian Influenza

105 Avian Flu Human Flu Novel Flu

106

107 Basi molecolari della virulenza di H5N1 Krug RM, Science 2006 K in pos 627 NS1 PQ-RERRKKR-G Sito di taglio C-terminale ESEWEPEV Altri fattori di virulenza HA NA ? ? NP M1 M2 PA, PB1, PB2

108

109 H1N1: caratteristiche virologiche Le passate pandemie ci hanno insegnato quali sono i principali determinanti di patogenicità : HA con RERRRKKR a livello del sito di taglio proteolitico Espressione della proteina PB1-F2 (ORF + 1 in PB1) PB2 importante determinante di specie specificità (aa 627) Porzione C-terminale di NS1 con il motivo ES/PEV

110

111 HA di H1N1v Priva delle regioni polibasiche che determinano la suscettibilità ad una ampio spettro di proteasi

112 HA di H1N1v Siti di legame al recettore tipici di molti virus suini classici H1N1, recentemente isolati –Mutazioni in siti non funzionalmente rilevanti Confronta tra H1 di H1N1v e l’H1 dei virus umani stagionali: mutazioni a livello di putativi siti antigenici

113 Da Garten RJ and al., Science 10 July 2009: Vol no. 5937, pp

114 PB1-F in H1N1v La sequenza presenta un codone di STOP (dopo 12 aa) che impedisce la traduzione della proteina di fusione

115 PB2 Molti virus influenzali aviari sono in grado di infettare cellule murine ma non sono in grado di replicare aa 627 di PB2 è fondamentale Nei virus aviari è acido glutammico, nei virus dei mammiferi è una lisina Importante per la specie-specificità

116 PB2 in H1N1v Tutti i virus H1N1v sequenziati finora hanno un Glu in posizione 627 –INASPETTATO: tipico dei virus aviari MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMMAMRYPITADKRIMDMIPER NEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRN QVKIRRRVDTNPGHADLSAKEAQDVIMEVVFPNEVGARILTSESQLAITKEKKEELKDCKIAPLMVAYM LERELVRKTRFLPVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSAD PLASLLEMCHSTQIGGVRMVDILRQNPTEEQAVDICKAAIGLRISSSFSFGGFTFKRTSGSSVKKEEEVL TGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAV RGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPSTEMSLRGIRVS KMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTY QWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQIIK LLPFAAAPPE Q SRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGM ESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRM AIN

117 NS1 Manca la sequenza ES/PEV (Stop in posizione 220) MDSNTMSSFQVDCFLWHIRKRFADNGLDAPFLDRL RRDQKSLKGRGNTLGLDIETATLVGKQIVEWILKE ESSETLRMTIASVPTSRYLSDMTLEEMSRDWFM LMPRQKIIGPLCVRLDQAVMEKNIVLKANFSVIFN RLETLILLRAFTEEGAIVGEISPLPSLPGHTYEDVK NAVGVLIGGLEWNGNTVRVSENIQRFAWRNCDE NGRPSLPPEQK

118 Resistenza ai farmaci Tutti gli H1N1v presentano resistenza agli adamantani (S31N in M2) Sono stati descritti solo alcuni ceppi di H1N1v resistenti all’osaltamivir (mutazioni a livello della NA, H275Y e I223V ) Finora nessun ceppo resistente è stato identificato in Italia

119 H1N1v: caratteristiche antigeniche Studi della letteratura dimostrano che H1N1v è antigenicamente omogeneo e simile ai virus dell’influenza suina classici e triplo riassortanti che hanno circolato nella popolazione animale americana negli ultimi 10 anni LA VARIABILITA’ ANTIGENICA TRA I VIRUS H1N1v CIRCOLANTI NELLA POPOLAZIONE UMANA E’ ALLO STATO ATTUALE INFERIORE A QUELLA OSSERVATA DURANTE UNA TIPICA STAGIONE INFLUENZALE

120 H1N1v: caratteristiche antigeniche Anticorpi specifici per H1N1v NON sembrano riconoscere H1N1 stagionale (Garten RJ et al. Science Jul 10;325(5937): ) Questo tuttavia NON esclude la possibiltà di cross-protezione nel caso di co-infezione con i due virus Tumpey et al. (Proc. Natl. Acad. Sci. U.S.A. 101, 3166 (2004)) dimostrarono una certa cross-reattività tra sieri ottenuti da individui vaccinati con il ceppo di influenza umana New Caledonia/20/1999 A(H1N1) e il ceppo A/Swine/Iowa/1930 A(H1N1) Il livello di protezione nei confronti di H1N1v in seguito a vaccinazione con il vaccino dell’nfluenza stagionale rimane tuttavia da determinare

121 Conclusioni H1N1v possiede una HA antigenicamente e geneticamente diversa da quella dei ceppi di influenza stagionale H1N1v presenta una composizione genetica mai descritta in precedenza H1N1v si trasmette efficientemente da uomo a uomo Allo stato attuale manca di determinanti di patogenicità tipici dei virus delle passate pandemiesintomi blandi Il monitoraggio costante delle proprietà atigeniche e genetiche di H1N1v è mandatorio al fine di rilevare ogni cambiamento che possa avere un impatto sulla patogenesi, sulla resistenza ai farmaci e sulla validità del vaccino


Scaricare ppt "Neuraminidase or N Protein Hemagglutinin or H Protein Fatty or Lipid Envelope Matrix Protein embrane Protein Coat or Nucleoprotein RNA Ortomyxovirus Virus."

Presentazioni simili


Annunci Google