La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

A.A. 2013-2014 CORSO INTEGRATO DI INFORMATICA E BIOINFORMATICA per il CLT in BIOLOGIA MOLECOLARE Scuola di Scienze, Università di Padova Docenti: Dr.

Presentazioni simili


Presentazione sul tema: "A.A. 2013-2014 CORSO INTEGRATO DI INFORMATICA E BIOINFORMATICA per il CLT in BIOLOGIA MOLECOLARE Scuola di Scienze, Università di Padova Docenti: Dr."— Transcript della presentazione:

1

2 A.A CORSO INTEGRATO DI INFORMATICA E BIOINFORMATICA per il CLT in BIOLOGIA MOLECOLARE Scuola di Scienze, Università di Padova Docenti: Dr. Mauro Conti (Informatica) e Dr. Stefania Bortoluzzi (Bioinformatica)

3 WORKING WITH BIOSEQUENCES Alignments and similarity search

4 Allineamento di sequenze Allineamento globale e allineamento locale Allineamento di sequenze a coppie o multiplo Ricerca di similarita’ BLAST WORKING WITH BIOSEQUENCES Alignments and similarity search

5 ALLINEAMENTO DI SEQUENZE Procedura per comparare due o piu’ sequenze, volta a stabilire un insieme di relazioni biunivoche tra coppie di residui delle sequenze considerate che massimizzino la similarita’ tra le sequenze stesse L’allineamento tra due sequenze biologiche è utile per scoprire informazione funzionale, strutturale ed evolutiva

6 Cosa vuol dire allineare due sequenze (proteine o acidi nucleici)? Scrivere due sequenze orizzontalmente in modo da avere il maggior numero di simboli identici o simili in registro verticale anche introducendo intervalli (gaps – inserzioni/delezioni – indels) seq1: TCATG seq2: CATTG TCAT-G.CATTG 4 caratteri uguali 1 inserzione/delezione

7 ALLINEAMENTO DI SEQUENZE A COPPIE AGTTTGAATGTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC ||||||||||||||||||| |||||||| ||| | |||||| ||||||||||||||||| AGTTTGAATGTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC MULTIPLO KFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl KYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKT- KFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl KFKHHLKEHIRIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV KYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTs

8 Allineamento GLOBALE o LOCALE GLOBALE  considera la similarità tra due sequenze in tutta la loro lunghezza LOCALE  considera solo specifiche REGIONI simili tra alcune parti delle sequenze in analisi Global alignment LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||. | | |.|.| || || | || TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHKAG Local alignment LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||||||||.|||| TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHK

9 ALLINEAMENTO GLOBALE ALLINEAMENTO LOCALE

10 AACCGAAGGACTTTAATC AAGGCCTAACCCCTTTGTCC AA..CCGAAGGACTTTAATC AACCGAAGGACT TTAATC || |..||...||||...| | |||.|| ||..|| AAGGCTAAACCCCTTTGTCC A AGGCCTAACCCCTTTGTC Fattibile solo per poche sequenze molto brevi! Possono esistere più allineamenti “equivalenti” seq1 AACCGTTGACTTTGACC Seq2ACCGTAGACTAATTAACC AACCGTTGACT..TTGACC | ||||.|||| ||.||| A.CCGTAGACTAATTAACC Allineamento manuale basato sulla massimizzazione del numero residui identici allineati Numero possibili allineamenti di due seq lunghe N N=250 

11 Un metodo molto semplice ed utile per la comparazione di due sequenze è quello della MATRICE DOTPLOT A|X X X T| X X G| X T| X X A T C A C T G T A C| X | | | | | | | A|X X X A T C A - - G T A C| X T| X X A|X X X A T C A G T A

12 A DNA dot plot of a human zinc finger transcription factor, showing regional self- similarity The main diagonal represents the sequence's alignment with itself Lines off the main diagonal represent similar or repetitive patterns within the sequence

13 GAP PENALTY SIMILARITY SCORE MATCHES MISMATCHES GAPS CALCOLO DEL PUNTEGGIO PER UN ALLINEAMENTO Data una coppia di sequenze Sa e Sb Per ogni coppia di elementi a i e b j di Sa e Sb si definisce un punteggio s(a i,b j ) s(a i,b j ) =  se a i = b j s(a i,b j ) =  se a i  b j, con  >  Ad ogni ogni gap viene assegnato un punteggio dato da: W k =  +  (k-1) Dove W k e’ una funzione lineare che assegna una penalita’ constante alla presenza del gap ( , ad es. -10) e una penalita’ proporzionale alla lunghezza del gap meno uno.  (gap opening penalty, GOP)  (gap extension penalty, GEP) Il punteggio complessivo risultera’:  (s(a i,b j ) ) +  ( W k )

14 ATTCCGAG | || A----GAC CALCOLO DEL PUNTEGGIO PER UN ALLINEAMENTO: ESEMPIO Sequenze:Possibile allineamento: ATTCCGAG AGAC Assegno i seguenti punteggi: Match: +2 Mismatch: -1 GOP: -5 GEP: -2 MATCHES33 x 2 = 6 MISMATCHES1 1 x –1 = -1 SIMILARITY SCORE  6 –1 = 5 GAPS1 (lungo 4 nucleotidi) GOP + GEP X 3 GOP-5GEP-2 x 3 GAP PENALTY  -5 + (3 x –2) = -11 PUNTEGGIO FINALE5 – 11 = -6

15 MISURE DI IDENTITA’ E DI SIMILARITA’ Il modo più semplice per definire le relazioni di similarità tra nucleotidi è basato solo su IDENTITA’ e DIVERSITA’. La piu’ semplice matrice di similarità per i nucleotidi è la “UNITARY SCORING MATRIX”, matrice che assegna punteggio 1 a coppie di residui identici e 0 ai mismatch. A C G T A | C | G | T | Possono esserci altri criteri per dare un peso diverso da zero a matches tra residui non identici (ad.es. pesare in modo diverso transizioni e transversioni)

16 MISURE DI IDENTITA’ E DI SIMILARITA’ E’ possibile misurare la similarità tra aminoacidi tenendo conto delle loro proprietà chimico-fisiche ad. es. l‘acido glutammico è più simile all’acido aspartico che alla fenilalanina Un altro modo per misurare la similarità tra aminoacidi è fondato sulle frequenze osservate di specifiche sostituzioni amminoacidiche in opportuni gruppi di allineamenti. La similarità tra due specifici aminoacidi (ed es. A e G) e’ proporzionale alla frequenza con cui si osserva la sostituzione corrispondente (A->G). Le MATRICI DI SOSTITUZIONE piu’ conosciute ed utilizzate sono le matrici PAM (o Dayhoff Mutation Data (MD) Matrices) e le matrici BLOSUM.

17 Matrici di sostituzione Le matrici di sostituzione si basano su evidenze biologiche Le differenze che si osservano tra sequenze omologhe negli allineamenti sono riconducibili ad eventi di mutazione Alcune di queste mutazioni hanno effetti trascurabili sulla struttura/funzione della proteina

18 LE PROTEINE : 20 AMMINOACIDI proteinogenici

19 Esempio di matrice di sostituzione ARNK A5-2 R-7 3 N--70 K---6 Nonostante K e R siano due amminoacidi diversi, hanno uno score positivo. Perchè? Sono entrambi amminoacidi carichi positivamente. A R N K

20 MATRICI PAM (Dayhoff et al. 1978) Sono basate sul concetto di mutazione puntiforme accettata, Point Accepted Mutation (PAM) Le prime matrici PAM sono state compilate in base all’analisi delle sostituzioni osservate in un dataset costituito da diversi gruppi di proteine omologhe: 1572 sostituzioni osservate in 71 gruppi di sequenze di proteine omologhe con similarità molto alta (85% di identità) La scelta di proteine molto simili era motivata dalla semplicità dell’allineamento, senza necessità di introdurre correzioni per multiple hits, ovvero sostituzioni quali A->G->A or A->G->N.

21 L’analisi degli allineamenti mostrò come diverse sostituzioni aminoacidiche si presentassero con frequenze anche molto differenti:  le sostituzioni che non alterano “seriamente” la funzione della proteina, quelle “accettate” dalla selezione, si osservano piu’ di frequente di quelle “distruttive”.  La frequenza osservata per ciascuna specifica sostituzione (es. aa J  aa K ) sul totale delle sostituzioni viene usata per stimare la probabilità della transizione corrispondente in un allineamento di proteine omologhe. Le probabilità di tutte le possibili sostituzioni sono riportate nella matrice PAM La matrice PAM1 di base definisce la probabilità di transizione di un aminoacido in un altro aminoacido che consente di conservare il 99% della sequenza.

22 Matrici BLOSUM - Blocks Substitution Matrix (Henikoff and Henikoff, 1992) Matrici di sostituzione derivate dallanalisi di oltre 2000 blocchi di allineamenti multipli di sequenze, che riguardavano regioni conservate di sequenze correlate. Per ridurre il contributo di coppie di amminoacidi di proteine altamente correlate, gruppi di sequenze molto simili sono state trattate come se fossero sequenze singole ed e’ stato calcolato il contributo medio di ciascuna posizione. Utilizzando diversi cut-off per il raggruppamento di sequenze simili si sono ottenute diverse matrici BLOSUM (BLOSUM62, BLOSUM80, …)  Il nome della matrici indica la distanza evolutiva (BLOSUM62 è stata creata usando sequenze che non avevano più del 62% di identità)

23 BLOSUM62 Substitution Matrix I punteggi rappresentano il log-odds score per ciascuna sostituzione:  logaritmo del rapporto tra la probabilità di osservare la sostituzione in sequenze evolutivamente correlate e la probabilità di osservarla per caso BLOSUM62

24 L’utilizzo della matrice di similarità appropriata per ciascuna analisi è cruciale per avere buoni risultati. Infatti relazioni importanti da un punto di vista biologico possono essere indicate da una significatività statistica anche molto debole. Sequenze poco divergenti     moltodivergenti BLOSUM80BLOSUM62BLOSUM45 PAM1 PAM120PAM250

25 ALGORITMI PER L’ALLINEAMENTO DI SEQUENZE Algoritmo di Needleman & Wunsch  allineamento globale Algoritmo di Smith & Waterman  allineamento locale Utilizzano la PROGRAMMAZIONE DINAMICA!

26 ALGORITMO DI NEEDLEMAN & WUNSCH PER L’ALLINEAMENTO GLOBALE Questo metodo permette di determinare l’allineamento globale ottimale attraverso un’interpretazione computazionale della matrice dotplot: le sequenze vengono comparate attraverso una matrice 2D, le celle rappresentanti matches hanno punteggio 1 (0 per i mismatches) L’allineamento ottimale viene calcolato ricorsivamente per sottosequenze via via più lunghe, cosa possibile in virtù dell’indipendenza e dell’additività dei punteggi di “sottoallineamenti” L’algoritmo prevede una serie di somme successive dei punteggi contenuti nelle celle, che dà luogo ad una matrice di punteggi, la cui analisi permette la costruzione dell’allineamento finale

27 Tre fasi 1.Determinazione residui identici 2.Per ogni cella, cercare il valore massimo nei percorsi che dalla cella stessa portano all’inizio della sequenza e dare alla cella il valore del maximum scoring pathway 3.Costruire l’allineamento ottimale, andando indietro dalla cella con il punteggio piu’ alto fino all’inizio della matrice ALGORITMO DI NEEDLEMAN & WUNSCH PER L’ALLINEAMENTO GLOBALE Questo metodo permette di determinare l’allineamento globale ottimale attraverso un’interpretazione computazionale della matrice dotplot.

28 Needleman-Wunsch Algorithm – FASE 1 Similarity values valore 1 oppure 0 ad ogni cella, in base alla similarita’dei residui corrispondenti Nell’esempio: –match = +1 –mismatch = 0 MPRCLCQRJNCBA P 1 B 1 R 1 1 C K C R 1 1 N 1 J 1 C J 1 A 1

29 Needleman-Wunsch Algorithm – FASE 2 Procedo da “in alto sinistra” verso “in basso a destra” nella matrice Per ogni cella, voglio determinare il valore massimo possibile per un allineamento che termini in corrispondenza della cella stessa Cerco le celle appartenenti alla colonna e alla riga precedenti a quelle della cella per trovare il valore massimo in esse contenuto Aggiungo questo valore al valore della cella corrente

30 Needleman-Wunsch Algorithm – FASE 2

31 Needleman-Wunsch Algorithm – FASE 3 Costruisco l’allineamento Il punteggio dell’allineamento e’ cumulativo (posso sommare lungo i percorsi nella direzione stabilita) Il miglior allineamento ha il massimo punteggio (ovvero il massimo numero di matches) Questo massimo numero di matches si ritrovera’ nelle ultime righe o colonne L’allineamento si costruisce andando indietro alla cella1,1 a partire dalla cella imn basso a destra con punteggio massimo. MP-RCLCQR-JNCBA | || | | | | | -PBRCKC-RNJ-CJA

32 Needleman-Wunsch Algorithm – FASE 3 MP-RCLCQR-JNCBA | || | | | | | -PBRCKC-RNJ-CJA

33 Allineamento locale. Perchè? Sequenze diverse possono presentare una o piu’ brevi regioni di similarità pur essendo diverse nelle restanti regioni. Queste potrebbero risultare non allineabili con un metodo per allineamento globale di sequenze. Esempio: –I geni Homeobox mostrano una regione di sequenza altamente conservata, codificante l’Homeodominio, un dominio legante il DNA. –Un allineamento globale tra sequenze di fattori di trascrizione diversi con omeodominio potrebbe non individuare la corrispondente regione di similarità, mentre un allineamento locale risulta estremamente utile.

34 Local alignment: homeodomains of 5 proteins The 5 proteins show similarity only in their Homeodomain regions These domains are combined with one or more different domains in different proteins

35 ALGORITMO DI SMITH & WATERMAN PER L’ALLINEAMENTO LOCALE Lo scopo degli algoritmi di allineamento locale di due sequenze e’ trovare la regione più lunga della prima sequenza che produce un allineamento ottimale, dati certi parametri, con una regione della seconda.

36 RICERCA DI SIMILARITÀ SIMILARITA’  ?  OMOLOGIA OMOLOGIA proprieta’ di caratteri (sequenze) dovuta alla loro derivazione dallo stesso antenato comune SIMILARITA’ “grado” di somiglianza tra 2 sequenze La similarita’ osservata tra due sequenze PUO’ indicare che esse siano omologhe, cioe’ evolutivamente correlate La similarita’ e’ una proprieta’ quantitativa, si puo’ misurare L’omologia e’ una proprieta’ qualitativa, non si puo’ misurare. La similarita’ tra sequenze si osserva, l’omologia tra sequenze si puo’ ipotizzare in base alla similarita’ osservata. Percentuale di similarita’ Ricerca di similarita’

37 OMOLOGIA E OMOPLASIA Omologia similarita’ dovuta a derivazione dallo stesso antenato comune Omoplasia similarita’ dovuta a convergenza, stessa pressione selettiva su due linee evolutive puo’ condurre a caratteri simili ORTOLOGIA E PARALOGIA OMOLOGIA ANTENATO COMUNE ORTOLOGIAPARALOGIA PROCESSO DI SPECIAZIONEDUPLICAZIONE GENICA Descrivo le relazioni tra geni di una famiglia intraorganismo (paralogia) o tra diversi organismi (ortologia )

38

39  Dimensioni delle banche dati  Ripetitività delle ricerche  Lentezza degli algoritmi “esatti” Sistemi rapidi ma approssimati di allineamento Metodi euristici per l’allineamento gli algoritmi esatti effettuano delle ricerche esaustive ed esplorano tutto lo spazio degli allineamenti possibili (programmazione dinamica) si tratta comunque di algoritmi di ordine n 2, ovvero per allineare due sequenze lunghe ognuna 1000 residui, effettuano 1000x1000 = un milione di confronti: troppo lenti!!!! la crescita esponenziale delle dimensioni delle banche dati di sequenze biologiche ha portato allo sviluppo di programmi (come FASTA e BLAST) in grado di effettuare velocemente ricerche di similarità, grazie a soluzioni euristiche che sono basate su assunzioni non certe, ma estremamente probabili. In pratica la ricerca è resa più veloce a scapito della certezza di avere veramente trovato la soluzione migliore.

40 BLAST Basic Local Alignment Search Tool (Altschul 1990) L’ algoritmo di BLAST e’ euristico e opera: 1Tagliando le sequenze da comparare in piccoli pezzi (parole) 2Ignorando tutte le coppie di parole (sequenza query/database) la cui comparazione da’ un punteggio inferiore ad un limite fissato 3Cercando di estendere tutte le hits rimanenti sino a che l’allineamento locale raggiunge un certo punteggio Dati una SEQUENZA QUERY ed un DATABASE DI SEQUENZE, BLAST ricerca nel database “parole” di lunghezza almeno “W” con un punteggio di similarita’ di almeno “T” una volta allineate con la sequenza “query” (HSP, High Scoring Pairs). Le “parole” selezionate vengono estese, se possibile, fino a raggiungere un punteggio superiore a “S” oppure un “E-value” inferiore al limite specificato.

41

42 1- Seeding In sequenze di DNA W = 7 In sequenze proteiche W = 2-3

43 Two-hits algorithm Le word-hits tendono a clusterizzare lungo le diagonali L’algoritmo two-hits richiede che le word-hits siano entro una distanza prestabilita

44 2 - Extension La fase successiva comporta l’estensione dei seed L’estensione avviene in entrambe le direzioni Blast ha un meccanismo per decidere quando fermare l’estensione

45 The quick brown fox jumps over the lazy dog ||| ||| ||||| | | || The quiet brown cat purrs when she sees him The quick brown fox jump ||| ||| ||||| | The quiet brown cat purr Evaluation Estensione verso destra >>>> Diamo punteggio +1 a ciascun match –1 a ciascun mismatch. Calcoliamo il drop off score a partire dal massimo raggiunto (punteggio 9). Quando il drop off raggiunge 5, si interrompe l’estensione. Score -> drop off score ->

46 ATAGGGCACTTT-GCGATGA ** * *** ** ***** ATTGCCCACGTTCGCGATCG Sequenze allineate Osservazione Ipotesi alternative OMOLOGIA? CASO? Significatività di un allineamento

47 Il risultato di una ricerca di similarita’ e’ una lista dei migliori allineamenti, tra la sequenza query e le sequenze “estratte” dal database. La SIGNIFICATIVITA’ di ciascun allineamento si calcola come P value o E value P value e’ la probabilita’ di ottenere un allineamento con punteggio uguale o migliore di quello osservato Si calcola mettendo in relazione il punteggio osservato (S) con la distribuzione attesa di HSP quando si comparano sequenze random della stessa lunghezza e composizione di quella in analisi (query sequence) Piu’ il P value e’ vicino a 0 piu’ e’ significativo 2x e’ meglio do !!! E value e’ il numero atteso di allineamenti con punteggio uguale o migliore di quello osservato Piu’ e’ basso piu’ e’ buono

48 Significatività di un allineamento Allineamento (matrice Blosum62, gap=-11) Seq1 V D C - C Y Seq2 V E C L C Y Score Score = 20 Sequenze randomizzate Seq1 Seq2 C D V Y C C V Y L E C Sequenze originali Seq1 Seq2 V D C C Y V E C L C Y Allineamento (matrice Blosum62, gap=-11) Seq1 Seq2 C D V Y - C C V E Y L C Score = 9 Score Score allineamento (20) Distribuzione score casuali Frequenza Score Ripetere (es volte) salvando tutti i punteggi

49 Usare BLAST OPZIONI Sequenza querynucleotidica proteica (sequenza in formato FASTA, GenBank Accession numbers o GI numbers) Databasedatabase di seq. nucleotidiche database di seq. proteiche ProgrammaStandard BLAST (blastn) Standard protein BLAST (blastp) translated blast (blastx, tblastn, tblastx) MEGABLAST PSI-BLAST PHI-BLAST … Blast selection table

50 Usare BLAST database di seq. nucleotidiche nr All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS, or phase 0, 1 or 2 HTGS sequences). No longer "non- redundant". est Database of GenBank+EMBL+DDBJ sequences from EST division. est_human est_mouse htgs Unfinished High Throughput Genomic Sequences yeast Saccharomyces cerevisiae genomic nucleotide sequences mito Database of mitochondrial sequences vector Vector subset of GenBank(R), NCBI, in month All new or revised GenBank+EMBL+DDBJ+PDB sequences alu Select Alu repeats from REPBASE, suitable for masking Alu repeats from query sequences. dbsts Database of GenBank+EMBL+DDBJ sequences from STS division. chromosome Searches Complete Genomes, Complete Chromosome, or contigs form the NCBI Reference Sequence project.

51 Usare BLAST PROGRAMMI Blastn Nucleotide query - Nucleotide db Blastp Protein query - Protein db Translating BLAST attraverso la traduzione concettuale della query sequence o dei database permette di comparare una sequenza nucleotidica con database di proteine o viceversa. Translated query - Protein db blastx Protein query - Translated db tblastn Translated query - Translated db tblastx MEGABLAST usa un algoritmo greedy (ingordo) veloce ed ottimizzato per comparare sequenze che differiscono poco Search for short nearly exact matches blastn con parametri scelti in modo da ottimizzare la ricerca di matches quasi esatti e brevi. Questi si trovano spesso per caso, percio’ utilizza alto E-value, piccola dimensione della parola e filtering PSI-BLAST Find members of a protein family or build a custom position- specific score matrix PHI-BLAST Find proteins similar to the query around a given pattern

52 WWW BLAST

53 WWW Blast: Risultati …

54

55

56

57 Allineamento multiplo di sequenze >Hs_jun-B MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF >Pt MCTKMEQPFYHDDSYTTTGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF >Bt MCTKMEQPFYHDDSYAAAGYGRTPGGLSLHDYKLLKPSLALNLSDPYRNLKAPGARGPGPEGNGGGSYFS SQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV KALDDLHKMNHVTPPNVSLGASGGPPAGPGGVYAGPEPPPVYTNLSSYSPASAPSGGAGAAVGTGSSYPT ATISYLPHAPPFAGGHPAQLGLGRGASAFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF >Clf MCTKMEQPFYHDDSYAAAGYGRAPGGLSLHDYKLLKPSLALNLADPYRSLKAPGARGPGPEGSGGSSYFS GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV KALDDLHKMNHVTPPNVSLGASSGPPAGPGGVYAGPEPPPVYTNLNSYSPASAPSGGAGAAVGTGSSYPT ATISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF

58 Clustal Omega Allineamento multiplo di sequenze

59

60 Ricostruzione Albero filogenetico

61 Jalview


Scaricare ppt "A.A. 2013-2014 CORSO INTEGRATO DI INFORMATICA E BIOINFORMATICA per il CLT in BIOLOGIA MOLECOLARE Scuola di Scienze, Università di Padova Docenti: Dr."

Presentazioni simili


Annunci Google