La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Informatica e Bioinformatica – A. A. 2013-2014 1 Purtroppo non esiste un modo univoco per indicare un gene. Ad esempio abbiamo visto che il gene tcap a.

Presentazioni simili


Presentazione sul tema: "Informatica e Bioinformatica – A. A. 2013-2014 1 Purtroppo non esiste un modo univoco per indicare un gene. Ad esempio abbiamo visto che il gene tcap a."— Transcript della presentazione:

1 Informatica e Bioinformatica – A. A Purtroppo non esiste un modo univoco per indicare un gene. Ad esempio abbiamo visto che il gene tcap a seconda del record è riportato come titin-cap protein o telethonin. Questo crea confusione e non facilita la ricerca informatica. The Human Genome Organisation (HUGO) ha istituito un comitato allo scopo di dare un unico nome significativo a tutti i geni umani. Con questo intento è stato costruito il database HGNC.

2 Informatica e Bioinformatica – A. A Oltre che esistere differenti nomi per lo stesso gene/proteina, possono esistere o essere adottati anche differenti modi per descrivere le loro funzioni e le loro localizzazioni. A volte è corretto assegnare diverse funzioni ad una molecola biologica (una proteina che svolge più di una funzione): per non generare confusioni è però necessario usare una terminologia univoca per ogni funzione. Per questo motivo è stato fondato il database Gene Ontology: fornisce una definizione precisa del ruolo svolto dalle singole proteine tramite un vocabolario (le ontologie) che consenta di definire in modo corretto e non arbitrario il o i processi biologici cui una proteina partecipa, la/e sue funzioni molecolari e la/e sue localizzazioni cellulare. Nota: i link con la sigla ‘GO’ rimandano al database della gene ontology

3 Informatica e Bioinformatica – A. A ALLINEAMENTO DI SEQUENZE

4 Informatica e Bioinformatica – A. A DATABASE DI SEQUENZE RICERCA TESTUALE SIMILARITÀ Ricerca dei record che hanno le sequenze più “simili” ad una sequenza fornita come query.  ora ci occuperemo di questa. Ricerca dei record i cui campi soddisfano determinati criteri.  già vista nelle precedenti lezioni

5 Informatica e Bioinformatica – A. A Acidi nucleici e proteine sono costituiti da sequenze lineari rispettivamente di nucleotidi e di aminoacidi; entrambi possono essere rappresentati da singole lettere o stringhe di caratteri. CONSIDERAZIONI GENERALI >gi| |ref|NM_ | Homo sapiens colipase, pancreatic (CLPS), mRNA CTGTCTCCCGCCACCCACACCAGCTGTCCCACTCACCATGGAGAAGATCCTGATCCTCCTGCTTGTCGCCCTC TCTGTGGCCTATGCAGCTCCTGGCCCCCGGGGGATCATTATCAACCTGGAGAACGGTGAGCTCTGCATGAA TAGTGCCCAGTGTAAGAGCAATTGCTGCCAGCATTCAAGTGCGCTGGGCCTGGCCCGCTGCACATCCATGG CCAGCGAGAACAGCGAGTGCTCTGTCAAGACGCTCTATGGGATTTACTACAAGTGTCCCTGTGAGCGTGGC CTGACCTGTGAGGGAGACAAGACCATCGTGGGCTCCATCACCAACACCAACTTTGGCATCTGCCATGACGCT GGACGCTCCAAGCAGTGAGACTGCCCACCCACTCCCACACCTAGCCCAGAATGCTGTAGGCCACTAGGCGC AGGGGCATCTCTCCCCTGCTCCAGCGCATCTCCCGGGCTGGCCACCTCCTTGACCAGCATATCTGTTTTCTG ATTGCGCTCTTCACAATTAAAGGCCTCCTGCAAACCTT >colipase-protein MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQH SSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVG SITNTNFG ICHDAGRSKQ  La stringa di caratteri è soltanto una rappresentazione semplificata del corrispondente acido nucleico o proteina, ma permette di gestire ed analizzare le sequenze mediante opportuni programmi informatici. Un acido nucleico rappresentato come stringa di caratteri, formato FASTA. La corrispondente proteina rappresentata come stringa di caratteri, formato FASTA.

6 Informatica e Bioinformatica – A. A Ricerca di similarità tra sequenze  Quando viene ottenuta una sequenza nucleotidica o proteica si cerca innanzitutto di individuarne la funzione. Come?  Viene subito in mente di cercare tra le sequenze già esistenti in database, alla ricerca di una o più sequenze che siano “confrontabili” alla nostra. Da questa ricerca cosa possiamo ottenere?  Nel caso più semplice, potremmo trovare una sequenza identica alla nostra, magari a funzione già nota. Potremo quasi sicuramente trasferire la funzione della sequenza target (subject) anche alla nostra sequenza query.  Potrebbe non esserci alcuna sequenza identica alla nostra. Dovremo in questo caso cercare le sequenze più simili alla nostra: in questo caso potremo formulare delle ipotesi sull’ipotetica funzione della nostra sequenza query. Più alto sarà il livello di similarità tra le sequenze, più attendibili saranno le nostre ipotesi. Database di sequenze Sequenza query Confronti  L’allineamento di sequenze basato sulla similarità è un metodo che ci permette di assegnare una probabile funzione a sequenze prima sconosciute.

7 Informatica e Bioinformatica – A. A  Se le sequenze di due proteine o di DNA sono molto simili, allora lo saranno anche le loro strutture e le funzioni.  Non è però vero il contrario. Infatti, proteine con funzione e struttura simili non hanno necessariamente sequenze simili (ad esempio i trasportatori di membrana).  Ci possono essere proteine con la stessa funzione, ma con struttura e soprattutto sequenza nucleotidica corrispondente diversa. Es. mutazioni silenti che interessano la terza base di un codone: l’aminoacido rimane lo stesso ma è cambiato il DNA! Quando inferire la funzione! SEQUENZA SIMILE STRUTTURA SIMILE FUNZIONE SIMILE

8 Informatica e Bioinformatica – A. A Allineamento delle sequenze Analisi comparata delle similarità Un aspetto importante della biologia è capire come si siano originate le strutture biologiche nel corso dell'evoluzione: evoluzione biologica e filogenesi. Analisi comparata classica: confrontando l'anatomia dei vertebrati, si può dedurre che i mammiferi si sono originati da un gruppo di rettili originati a loro volta da un gruppo di anfibi, originati a loro volta da un gruppo di pesci. Analisi comparata a livello molecolare: confrontando sequenze proteiche in organismi diversi è possibile ricostruire passo dopo passo l'evoluzione delle proteine nel corso della filogenesi e capire come esse abbiano affinato le loro funzioni; oppure come siano nate funzioni nuove da proteine ancestrali con funzioni diverse.  l’allineamento di sequenze è oggi alla base di molti studi di filogenesi molecolare. Set di geni/proteine Organismo A Set di geni/proteine Organismo B Set di geni/proteine Organismo C Set di geni/proteine Organismo D Set di geni/proteine Organismo E Costruzione dell’albero filogenetico degli organismi A C E B D Analisi comparata

9 Informatica e Bioinformatica – A. A Alcune definizioni: Similarità, omologia ed analogia Spesso si fa confusione tra similarità ed omologia. La similarità è un aspetto quantitativo che indica un livello di somiglianza tra le sequenze: prevede che venga fissato un criterio comparativo ( % identità, % mutazioni conservative ecc.). L’omologia è un aspetto qualitativo che riguarda più propriamente la “funzione” delle sequenze ed indica un’origine filogenetica comune. L'omologia presuppone l'esistenza di un organismo ancestrale comune da cui le strutture omologhe si sono evolute. Ad esempio l'ala di un uccello e la pinna anteriore di una foca sono omologhi perché si suppone che si siano entrambi evoluti dall'arto anteriore di un rettile ancestrale. Invece, il termine analogia indica che due strutture hanno una funzione simile, ma che si sono evolute indipendentemente. Ad esempio l'ala di un uccello e quella di una farfalla: la similarità in questo caso è determinata da una convergenza adattativa e non dalla stessa origine evolutiva.

10 Informatica e Bioinformatica – A. A Il termine omologia si applica anche a sequenze di acidi nucleici e proteine: due geni sono omologhi se hanno un gene ancestrale da cui sono originati entrambi. La similarità tra due sequenze è generalmente dovuta ad una origine evolutiva comune per cui molto spesso i termini "similarità" e "omologia" si confondono.  Quando non si è certi di un’origine evolutiva comune si dovrebbe parlare di similarità. Un errore ancora più grave è di parlare di percentuale di omologia, che non ha nessun senso.

11 Informatica e Bioinformatica – A. A  speciazione: origine di una nuova specie da una già esistente Evoluzione genica ed omologia (A) Quando due geni omologhi derivano dalla speciazione si parla di geni ortologhi. (B) Quando due geni omologhi derivano dalla duplicazione genica, si parla di geni paraloghi. Deve essere chiaro che sia i geni paraloghi che i geni ortologhi sono omologhi perchè il termine omologia si riferisce all’esistenza di un comune ancestor.

12 Informatica e Bioinformatica – A. A Vertebrati Pesci con alfa e beta globine Pesci con un solo gene per la globina Pesci con alfa e beta globine Anfibi Rettili Anfibi RettiliMammiferi Globina di uomo ESEMPIO Nel corso dell'evoluzione dei vertebrati (prima della evoluzione degli anfibi), si è verificato un evento di duplicazione del gene della globina (globina alfa e beta). Oggi alcuni pesci hanno un singolo gene, mentre altri ne hanno due: uno simile alla globina alfa e uno alla globina beta. Dai pesci con due globine si sono evoluti gli anfibi, e da questi rettili, uccelli e mammiferi. Tutti i geni della globina sono omologhi in quanto derivano da un unico gene ancestrale: - i geni delle globine alfa sono ortologhi tra loro così come i geni delle globine beta; - i geni dell’alfa e beta globina sono paraloghi tra loro in quanto derivano da un processo di duplicazione genica.

13 Informatica e Bioinformatica – A. A Cominciamo ad allineare tra loro le sequenze: la DOT MATRIX  Il primo semplice sistema di visualizzazione di allineamenti risale al 1970 e si chiama metodo della Dot Matrix (matrice a punti).  Le due sequenze da confrontare sono inserite ai margini di una matrice. Se le due lettere corrispondenti ad una casella sono uguali, allora la casella viene colorata di nero ed apparirà come un punto (dot) all’interno della matrice.  Gli allineamenti di una certa lunghezza appariranno come segmenti diagonali e saranno distinguibili visivamente.

14 Informatica e Bioinformatica – A. A Confrontando due sequenze identiche (la stessa sequenza sia in orizzontale che verticale) otterremo una diagonale continua che parte dall'angolo in alto a sinistra per arrivare a quello in basso a destra. Analisi della matrice NOTA: statisticamente parlando, dal confronto tra sequenze proteiche ci possiamo aspettare una casella positiva ogni 20. Ancor di più, dal confronto di sequenze di acidi nucleici potremmo avere una casella positiva ogni 4: si crea un notevole rumore di fondo. Variazione del rumore di fondo con diversi valori del parametro window. Un modo per ridurre il rumore di fondo è di considerare la media dei valori presenti sulla diagonale all’interno di una determinata finestra (window) invece che considerare le singole caselle della matrice.

15 Informatica e Bioinformatica – A. A Significato della diagonale posta in prossimità dell'angolo in alto a destra: la parte finale della sequenza orizzontale è simile alla parte iniziale della sequenza verticale. In altre parole, la sequenza verticale è simile alla sequenza orizzontale in due porzioni distinte, possibilmente generate da parziale duplicazione del gene. Osservazioni  Una diagonale parallela quella principale indica una parziale duplicazione genica o la presenza di domini multipli.

16 Informatica e Bioinformatica – A. A La diagonale principale della figura mostra un'evidente interruzione nella parte centrale per poi continuare su una diagonale diversa, un po' più bassa. Questi salti di diagonale sono dovuti ad alcuni segmenti di sequenza che sono presenti in una sequenza, ma non nell'altra. In altre parole, una sequenza possiede un gap (discontinuità, buco) rispetto all’altra. Nel caso del nostro esempio abbiamo un gap (delezione) nella sequenza orizzontale o, se si preferisce, un segmento di sequenza aggiuntivo (inserzione) nella sequenza verticale. Esempio di gap tra due sequenze

17 Informatica e Bioinformatica – A. A Schema per l’interpretazione della Dot Matrix

18 Informatica e Bioinformatica – A. A Con l'approccio della dot matrix viene semplicemente mostrata una matrice, la quale viene in seguito interpretata visivamente ed in modo soggettivo. Abbiamo bisogno di un sistema che sia anche in grado di estrarre i dati dalla matrice e trovare automaticamente gli allineamenti migliori, cioè di identificare il "percorso" migliore all'interno della matrice. Occorre individuare un metodo per confrontare sequenze che utilizzi un criterio per quantificare il grado di similarità tra sequenze.  servono dei programmi informatici capaci di utilizzare appositi algoritmi di allineamento (metodo di allineamento) e che sfruttino un criterio di similarità capace di stimare la bontà di un certo allineamento.

19 Informatica e Bioinformatica – A. A Per determinare la similarità tra due sequenze dobbiamo quindi definire: 1. l’algoritmo di allineamento 2. il criterio di similarità RICERCA DELLE SIMILARITÀ TRA 2 SEQUENZE 1. ALGORITMO DI ALLINEAMENTO Un algoritmo è caratterizzato da l’insieme di tutte le operazioni da eseguire per risolvere un problema (determinazione di tutti i possibili allineamenti); la complessità, cioè da come varia il numero delle operazioni da effettuare al variare della dimensione del problema: il tempo di esecuzione del programma che implementa l’algoritmo è infatti proporzionale alla complessità dell’algoritmo! Esempio: algoritmo di scorrimento. Si fa scorrere una sequenza sull’altra contando le identità tra le due sequenze 4 identità

20 Informatica e Bioinformatica – A. A CRITERIO DI SIMILARITÀ Funzione di score L’allineamento delle sequenze dovrebbe essere caratterizzato da un punteggio (score), col quale è possibile valutare (secondo i criteri impostati) il grado di similarità. Ad esempio, con l’algoritmo di scorrimento e una semplice funzione di score che assegni ‘1’ se le lettere tra le due sequenze sono uguali; ‘0’ se le lettere sono diverse, per ogni allineamento si ricava uno score dato dalla somma ottenuta da tutti gli appaiamenti. Il ‘miglior’ allineamento potrebbe essere quello che ha ottenuto il maggior punteggio. Adozione di criteri differenti  funzioni di score differenti  score finali differenti Questo esempio di funzione di score potrebbe non rappresentare un criterio molto valido: non ha senso penalizzare tutte le differenze (i mismatch) allo stesso modo! in genere nelle proteine la sostituzione tra aminoacidi carichi non comporta grandi cambiamenti strutturali, mentre la sostituzione di aminoacidi aromatici con altri carichi comporta spesso pesanti cambiamenti conformazionali. Per questo sono state introdotte le matrici di sostituzione (vedi prossima slide). Inoltre possono essere adottate particolari penalità (score) per l’apertura o l’estensione di un gap che si sommano allo ‘score’ totale.

21 Informatica e Bioinformatica – A. A LE MATRICI DI SOSTITUZIONE Nel caso dell’allineamento di aminoacidi è opportuno applicare dei criteri di similarità che non si limitino a verificare l’identità assoluta, ma tengano conto del fatto che gli aminoacidi possono essere più o meno simili tra loro: aminoacidi molto simili possono essere indifferentemente sostituiti in una proteina senza una variazione apprezzabile nella struttura (e quindi funzione) della proteina. Per esempio acido aspartico (D) e acido glutammico (E) sono molto simili e nel corso dell’evoluzione prendono facilmente il posto l’uno dell’altro nelle proteine. Viceversa acido aspartico (D) e triptofano (W) sono molto diversi e non sono interscambiabili. E’ ragionevole valutare differentemente la sostituzione di D con E e di D con W. Questa tipologia di confronti viene descritta in matrici quadrate di 20x20 caselle in cui si attribuisce un punteggio ad ogni possibile coppia di aminoacidi: - più alto è il punteggio tanto più interscambiabili sono gli aminoacidi; - punteggi negativi penalizzano invece aminoacidi molto differenti. Approfondiamo brevemente le matrici di sostituzione più diffuse, le matrici PAM e le matrici BLOSUM.

22 Informatica e Bioinformatica – A. A Sono basate su uno studio di filogenesi molecolare condotto su 71 famiglie di proteine nel 1978 da Margareth Dayhoff e collaboratori. E’ stata effettuata una ricostruzione dell’evoluzione molecolare delle proteine, in cui ad ogni passaggio evolutivo si presuppone una sostituzione aminoacidica. MATRICI PAM ( point accepted mutation) Le matrici PAM (mutazioni puntiformi accettate) elencano la probabilità di cambiamento da un aminoacido ad un altro in sequenze proteiche omologhe nel corso dell’evoluzione. PAM1 rappresenta un singolo passaggio evolutivo (il primo) che tiene conto della probabilità di sostituzione di ogni aminoacido con ciascun altro e tale da prevedere una mutazione ogni 100 aminoacidi.

23 Informatica e Bioinformatica – A. A I passi evolutivi successivi vengono simulati applicando nuovamente le probabilità di sostituzione definite in PAM 1 per ricalcolare, ad ogni nuovo passo, nuove probabilità di sostituzione. Una distanza evolutiva di 100 PAM non corrisponde alla sostituzione del 100% degli aminoacidi, ma a 100 passi evolutivi. Possiamo simulare qualsivoglia distanza evolutiva e calcolarne la corrispondente PAM. Alla fine della simulazione otteniamo dei punteggi che ci indicano quanto più probabile è che l’appaiamento tra gli aminoacidi sia dovuto ad omologia piuttosto che al caso. Nota: il modello prevede che le sostituzioni aminoacidiche osservate a grandi distanze evolutive derivino esclusivamente dalla somma di tante mutazioni indipendenti.

24 Informatica e Bioinformatica – A. A MATRICI BLOSUM (1992, Henikoff and Henikoff) Sono basate sulla banca dati BLOCKS, la quale contiene una collezione di allineamenti multipli di segmenti proteici (senza gap). I blocchi sono derivati da osservazione diretta, cioè non viene fatta nessun tipo di assunzione di omologia. Ogni blocco di allineamenti contiene sequenze con un numero di aminoacidi identici superiore ad una certa percentuale (P). Ad esempio, una BLOSUM60 corrisponde ad un 60 % di identità minima (più alto è l’indice, tanto più ci si avvicina alla matrice di identità). Da ognuno di questi blocchi è possibile (reiterando il calcolo in modalità simili al metodo PAM) ricavare la frequenza relativa di sostituzione degli aminoacidi e costruire delle matrici di sostituzione.

25 Informatica e Bioinformatica – A. A Le tabelle (o matrici) di sostituzione dei 20 aminoacidi comprendono: 190 valori di relazione tra aminoacidi diversi, più 20 valori di identità, per un totale di 210 valori. Spesso queste matrici sono riportate anche nella loro parte speculare per un totale di altri 190 valori, uguali ai primi. Il tutto si può facilmente rappresentare con una matrice di 20x20, 400 valori. Questa tabella corrisponde alla matrice PAM240, una delle più comunemente usate per allineare tra loro sequenze di aminoacidi. In genere, per ogni coppia: valori alti  aa. identici; medi  aa. “simili”; bassi  aa. molto “differenti” (ad esempio W & G = -7).

26 Informatica e Bioinformatica – A. A Matrici PAM: si basano sulla frequenza con cui ciascun aminoacido può subire un evento di sostituzione calcolato mediante uno studio di filogenesi molecolare (esistono matrici PAM1, PAM10, ecc. che si differenziano per i ‘passi evolutivi’ considerati nel loro calcolo) Matrici BLOSUM: sono invece basate su una banca dati (BLOCKS) di allineamenti multipli di segmenti proteici senza gap. (anche in questo caso esistono differenti matrici BLOSUM adatte per allineamenti tra sequenze con differenti distanze filogenetica) Esistono diverse matrici PAM e BLOSUM, che servono per confrontare sequenze simili oppure molto divergenti. Questo perché si basano sulle frequenze di sostituzione osservate in famiglie di proteine simili, che variano in base alla distanza evolutiva delle stesse famiglie di proteine. PAM80  PAM120  PAM200  PAM250: aumento distanza evolutiva. BLOSUM80  BLOSUM62  BLOSUM45: aumento distanza evolutiva. In sintesi Perché le BLOSUM “vanno” all’opposto?

27 Informatica e Bioinformatica – A. A Esistono altre matrici di sostituzione basate su differenti criteri di similarità chimica, oppure sul numero minimo di mutazioni necessarie per sostituire il codone di un aminoacido in un altro. Esistono matrici di sostituzione anche per le sequenze di DNA. Queste matrici contengono informazioni sull'occorrenza di transizioni (purina a purina, pirimidina a pirimidina) e transversioni (purina a pirimidina, e viceversa). I principali programmi di allineamento tra sequenze usano le matrici PAM e BLOSUM per assegnare i punteggi di allineamento (funzione di score).

28 Informatica e Bioinformatica – A. A Proviamo a confrontare due sequenze allineandole tra loro 1. Le due sequenze sono entrambe formate da 11 A, 9 T, 13 C, 7 G: sono simili ? ACTTCACCCTAGCTTTCTCGACTGCAGAGAAACTAGCCGA CAGCACGTGGCTTACTCACTACCAGTTCTCACAGAATGCA 2. Due sequenze di 39 basi hanno lo stesso contenuto in basi. Se allineate, notiamo 22 basi identiche: più del 50%. Possiamo considerarle simili o no? ACTTCACCCTAGCTTTCTCGACTGCAGAGAAACTAGCCGA | | | | | | | || | | | | || | || | | || ATTCCCCACGATCGTTTCCTAGTCCGGAAACACAACCGGA 3. Anche queste due sequenze hanno 22 basi allineate ed identiche. Come le consideriamo? Come nel caso precedente o in altro modo? ACTTCACCCTAGCTTTCTCGACTGCAGAGAAACTAGCCGA | || | |||||||||||||||| | | TAGTAGCCGACCATTTCTCGACTGCAGACCTTAATTAGTT 4a. Date le due sequenze sovrapposte: ACTTTCACCCTAGCTTTCTCGACTGCAGAGAAACTAGCCGA | || || | | | | | CAAAGCGCGAAAACTTTCACCCTAGCTTTCTCGACTGCAGAG è sufficiente traslare una delle sequenze per ottenere: ACTTTCACCCTAGCTTTCTCGACTGCAGAGAAACTAGCCGA CAAAGCGCGAAAACTTTCACCCTAGCTTTCTCGACTGCAGAG

29 Informatica e Bioinformatica – A. A Consideriamo i seguenti due differenti allineamenti delle stesse sequenze Nel primo caso si hanno 14 identità (evidenziate dalle linee verticali) e tre sostituzioni conservative (evidenziate dai punti) distribuite su tutta la lunghezza della sequenza. Nel secondo caso si hanno 13 identità ed una sostituzione conservativa su una regione di 14 aminoacidi. Quale dei due allineamenti è da considerarsi migliore? ALLINEAMENTI GLOBALI E LOCALI. |

30 Informatica e Bioinformatica – A. A Dal punto di vista biologico generalmente vengono privilegiati gli allineamenti locali, che riguardano regioni limitate delle proteine o di acidi nucleici. Abbiamo già parlato di domini delle proteine o anche degli acidi nucleici. Se ad esempio siamo interessati a trovare tutte le sequenze di proteine di una banca dati che contengono un certo dominio, allora sicuramente si cercheranno similarità locali. Gli allineamenti globali vengono applicati quando si vogliono confrontare accuratamente due sequenze in cui la similarità sia estesa per tutta la lunghezza. N.B. Un allineamento locale non è necessariamente limitato ad una piccola regione della sequenza, ma potrebbe estendersi anche all’intera lunghezza della sequenza. ALLINEAMENTI GLOBALI O LOCALI?

31 Informatica e Bioinformatica – A. A Alcuni programmi, come BLAST, sono estremamente efficienti e sono in grado di portare a termine una ricerca di similarità in pochi secondi. Questi programmi si basano essenzialmente su procedure che, per ogni sequenza del database: * effettua l'allineamento; * attribuisce un punteggio; * se il punteggio è alto lo memorizza; * ripete fino alla fine delle sequenze; * mostra la lista dei migliori allineamenti trovati. Ricerca di similarità di sequenza in banche dati La ricerca di similarità di sequenze in banche dati è diventata una operazione molto importante in diversi settori della biologia. I programmi che effettuano questa operazione si basano sul confronto sistematico di una sequenza di partenza (la query) con ognuna delle sequenze del database (dette subject). Database di sequenze Sequenza query Confronti

32 Informatica e Bioinformatica – A. A Il programma più usato per fare ricerche di similarità in banche dati è BLAST. In questo corso ci limiteremo a descriverne alcune applicazioni e a capire il significato dei risultati. BLAST può essere installato e fatto funzionare in un PC locale (nel proprio PC) oppure è accessibile dalla rete ad esempio al sito: dove può essere direttamente utilizzato per effettuare ricerche di similarità in banche dati.http://www.ncbi.nlm.nih.gov/BLAST/ E' inoltre disponibile un dettagliato "Blast tutorial" dove possono essere trovate informazioni approfondite sull'uso del programma e sull'algoritmo."Blast tutorial" BLAST Basic Local Alignment Search Tool

33 Informatica e Bioinformatica – A. A All’NCBI sono reperibili numerosi tutorial e questo vale anche per BLAST …fino alla definizione di terminologie molto tecniche e fondamentali Sono introdotti concetti molto generali…

34 Informatica e Bioinformatica – A. A Sono state sviluppate diverse applicazioni base del programma BLAST che consentono di ricercare sequenze sia a livello di acidi nucleici che di proteine: BLASTP → cerca similarità in una banca dati di sequenze di aminoacidi a partire da una sequenza query di aminoacidi; BLASTN → cerca similarità in una banca dati di sequenze nucleotidiche a partire da una sequenza query di nucleotidi; BLASTX → cerca similarità in una banca dati di sequenze di aminoacidi a partire da una sequenza query di nucleotidi, dopo aver tradotto automaticamente la query in aminoacidi utilizzando tutti i possibili frame di lettura* (cosa sono??); TBLASTN → cerca similarità in una banca dati di sequenze di nucleotidi a partire da una sequenza query di aminoacidi, traducendo automaticamente ogni sequenza della banca dati utilizzando tutti i possibili frame di lettura; TBLASTX → cerca similarità in una banca dati di sequenze di nucleotidi a partire da una sequenza query di nucleotidi, traducendo sia la query che le sequenze subject in aminoacidi, in tutte le possibili fasi di lettura (fasi=frame).

35 Informatica e Bioinformatica – A. A * Riguardo al BLASTX (ma anche al TBLASTN e TBLASTX), cosa può significare la frase: “dopo aver tradotto automaticamente la query (subject) in amminoacidi utilizzando tutti i possibili frame di lettura”? Questi concetti sono già stati introdotti nel corso: fateli vostri!


Scaricare ppt "Informatica e Bioinformatica – A. A. 2013-2014 1 Purtroppo non esiste un modo univoco per indicare un gene. Ad esempio abbiamo visto che il gene tcap a."

Presentazioni simili


Annunci Google