La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

TAS2R38 Bitter Receptor Gene LA VARIAZIONE GENETICA ASSOCIATA ALLA PERCEZIONE DEL GUSTO AMARO.

Presentazioni simili


Presentazione sul tema: "TAS2R38 Bitter Receptor Gene LA VARIAZIONE GENETICA ASSOCIATA ALLA PERCEZIONE DEL GUSTO AMARO."— Transcript della presentazione:

1 TAS2R38 Bitter Receptor Gene LA VARIAZIONE GENETICA ASSOCIATA ALLA PERCEZIONE DEL GUSTO AMARO

2 Beatrice Zanini La diversa capacità percettiva dell’amaro è un tipico carattere genetico ereditario ed è dovuta a un gene chiamato TAS2R38 responsabile della produzione di recettori gustativi per l’amaro

3 Beatrice Zanini I recettori sono costituiti dai calici gustativi presenti nelle papille gustative della lingua, nel palato molle, nella faringe, nelle guance e nell' epiglottide. Il gusto dipende dalla percezione sinergica di cinque gusti fondamentali: amaro, aspro, dolce, salato e umami

4 Beatrice Zanini I profili di risposta dei diversi stimoli, sia dolci che amari, possono essere estremamente diversi gli uni dagli altri. Inoltre, lo spazio gustativo è continuo. Sulla lingua, le gemme gustative sono localizzate su specifiche protrusioni, le papille

5 Beatrice Zanini Papille : - Circumvallate ~ 1000 nella zona posteriore della lingua particolarmente sensibili alle sostanze amare - Foliate contengono da dozzine a centinaia di gemme gustative nella porzione latero-posteriore della lingua e sono sensibili al salato e all’amaro. - Fungiformi 1 o poche gemme gustative nella porzione anteriore della lingua sembrano mediare la percezione di composti dolci differenti aree della lingua presentano forti preferenze per specifiche modalità gustative, ma anche una significativa sovrapposizione tra le varie regioni

6 Beatrice Zanini Cellule epiteliali modificate - Sono deputate al riconoscimento di stimoli gustativi - Sono connesse al cavo orale attraverso un sottile processo simile ad un dendrite -Presentano proprietà eccitatorie - Sono attivate da stimoli gustativi

7 Beatrice Zanini Un’apertura alla superficie dell’epitelio il poro gustativo permette l’accesso degli stimoli chimici ai recettori localizzati sui microvilli apicali delle cellule gustative.

8 Beatrice Zanini Il recettore, attivato in seguito alla stimolazione, genera una cascata trasduzionale che culmina nel rilascio di neurotrasmettitori al livello delle sinapsi con le fibre nervose (nervi facciale, vago e glossofaringeo) alla base delle gemme gustative. Probabile meccanismo di trasmissione del segnale Le fibre nervose eccitate conducono lo stimolo,via talamo, ai centri corticali del gusto, dove l’informazione è integrata e processata. Questo processo è ancora in larga parte sconosciuto.

9 Beatrice Zanini Uno studio pubblicato da un gruppo di ricercatori dell’Istituto di Biologia Evolutiva di Barcellona dimostra che l’uomo di Neanderthal, anni fa, era in grado di percepire il gusto amaro dei cibi che ingeriva, …….proprio come l’uomo moderno ! Lo studio genetico ha analizzato il gene TAS2R38 in un campione di osso prelevato da un uomo di Neanderthal rinvenuto nel 2000 a El Sidron, nel nord della Spagna.

10 Beatrice Zanini MA… La presenza di individui portatori del gene che li rende insensibili all’amaro, anche dopo anni di evoluzione, suggerisce il fatto che questo tratto genetico si sia conservato per un vantaggio dei portatori La ricerca, pubblicata su Biology Letters, dimostra la vicinanza genetica tra l’H. Sapiens e l’H. Neanderthalensis, che condividono un gene ereditato da un comune antenato, vissuto più di anni fa. L’abilità di percepire le sostanze amare rappresenta quindi una difesa contro le tossine vegetali e i veleni spesso contenuti in piante dal sapore amaro.

11 Beatrice Zanini I ricercatori hanno estratto il DNA dal fossile d’osso e hanno ottenuto la sequenza del gene specifico per il recettore delle sostanze amare. I nostri antenati erano in grado di percepire il gusto amaro dei cibi ! Ma il dato rilevante è che nella loro popolazione, come oggi nella nostra, esistevano due gruppi di persone: quelle capaci di percepire l’amaro TASTER quelli insensibili a questa sostanza NON TASTER

12 Beatrice Zanini Il TAS2R38 non è l’unico recettore per l’amaro Questa famiglia è stata individuata inizialmente mediante un approccio combinato bioinformatico e di analisi genetica. La famiglia dei TAS2R È composta di almeno 25 membri

13 Beatrice Zanini TAS2R38 E’ fatto di un singolo esone codificante un recettore a serpentina della lunghezza media di 330 aminoacidi.

14 Beatrice Zanini

15 GENE ORIGIN = EXON total length: ’UTR 1 cctttctgca ctgggtggca accaggtctt tagattagcc aactagagaa gagaagtaga 61 atagccaatt agagaagtga catc atg ttg actctaactc gcatccgcac tgtgtcctat 121 gaagtcagga gtacatttct gttcatttca gtcctggagt ttgcagtggg gtttctgacc 181 aatgccttcg ttttcttggt gaatttttgg gatgtagtga agaggcaggc actgagcaac 241 agtgattgtg tgctgctgtg tctcagcatc agccggcttt tcctgcatgg actgctgttc 301 ctgagtgcta tccagcttac ccacttccag aagttgagtg aaccactgaa ccacagctac 361 caagccatca tcatgctatg gatgattgca aaccaagcca acctctggct tgctgcctgc 421 ctcagcctgc tttactgctc caagctcatc cgtttctctc acaccttcct gatctgcttg 481 gcaagctggg tctccaggaa gatctcccag atgctcctgg gtattattct ttgctcctgc 541 atctgcactg tcctctgtgt ttggtgcttt tttagcagac ctcacttcac agtcacaact 601 gtgctattca tgaataacaa tacaaggctc aactggcaga ttaaagatct caatttattt 661 tattcctttc tcttctgcta tctgtggtct gtgcctcctt tcctattgtt tctggtttct 721 tctgggatgc tgactgtctc cctgggaagg cacatgagga caatgaaggt ctataccaga 781 aactctcgtg accccagcct ggaggcccac attaaagccc tcaagtctct tgtctccttt 841 ttctgcttct ttgtgatatc atcctgtgtt gccttcatct ctgtgcccct actgattctg 901 tggcgcgaca aaataggggt gatggtttgt gttgggataa tggcagcttg tccctctggg 961 catgcagcca tcctgatctc aggcaatgcc aagttgagga gagctgtgat gaccattctg 1021 ctctgggctc agagcagcct gaaggtaaga gccgaccaca aggcagattc ccggacactg 1081 tgc tga gaat ggacatgaaa tgagctcttc attaatacgc ctgtgagtct tcataaatat 1141 gcc 3’UTR

16 Beatrice Zanini CDS total length: 1,002 1 atg ttgactc taactcgcat ccgcactgtg tcctatgaag tcaggagtac atttctgttc 61 atttcagtcc tggagtttgc agtggggttt ctgaccaatg ccttcgtttt cttggtgaat 121 ttttgggatg tagtgaagag gcaggcactg agcaacagtg attgtgtgct gctgtgtctc 181 agcatcagcc ggcttttcct gcatggactg ctgttcctga gtgctatcca gcttacccac 241 ttccagaagt tgagtgaacc actgaaccac agctaccaag ccatcatcat gctatggatg 301 attgcaaacc aagccaacct ctggcttgct gcctgcctca gcctgcttta ctgctccaag 361 ctcatccgtt tctctcacac cttcctgatc tgcttggcaa gctgggtctc caggaagatc 421 tcccagatgc tcctgggtat tattctttgc tcctgcatct gcactgtcct ctgtgtttgg 481 tgctttttta gcagacctca cttcacagtc acaactgtgc tattcatgaa taacaataca 541 aggctcaact ggcagattaa agatctcaat ttattttatt cctttctctt ctgctatctg 601 tggtctgtgc ctcctttcct attgtttctg gtttcttctg ggatgctgac tgtctccctg 661 ggaaggcaca tgaggacaat gaaggtctat accagaaact ctcgtgaccc cagcctggag 721 gcccacatta aagccctcaa gtctcttgtc tcctttttct gcttctttgt gatatcatcc 781 tgtgttgcct tcatctctgt gcccctactg attctgtggc gcgacaaaat aggggtgatg 841 gtttgtgttg ggataatggc agcttgtccc tctgggcatg cagccatcct gatctcaggc 901 aatgccaagt tgaggagagc tgtgatgacc attctgctct gggctcagag cagcctgaag 961 gtaagagccg accacaaggc agattcccgg acactgtgct ga

17 Beatrice Zanini Protein product length: 333 translation MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSD CVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWL AACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSR PHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVS LGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCVAFISVPLLILW RDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKA DSRTLC Family A G protein-coupled receptor-like

18 Beatrice Zanini II TAS2R38 è il più studiato di questi geni. Alcune variazioni alleliche sono responsabili della percezione del gusto amaro di due sostanze usate come riferimento: PTC(PhenilThioCarbamide) PROP ((PropilTioUracile) Tre SNPs sono responsabili di tre sostituzioni aminoacidiche nella proteina nelle posizioni: A49P (rs713598) (Alanina/Prolina) A262V (rs ) (Alanina/Valina) I296IV (rs ) (Isoleucina/Valina) Il 2° e il 3° SNP sono in perfetto linkage disequilibrium

19 Beatrice Zanini Queste varianti danno origine a: PAV-taster PAV/PAV o PAV/AVI (cioè possiedono uno o due alleli dominanti) AVI-non taster AVI/AVI recessivi per questo carattere Avremo quindi tre genotipi: 1.PAV/PAV super-taster con alta sensibilità per l’amaro 2.PAV/AVI medium taster con moderata sensibilità per PTC/PROP 3. AVI/AVI non taster non percepiscono l’amaro

20 Beatrice Zanini Nella popolazione bianca - la più studiata - la distribuzione dei tre fenotipi è di circa: 30% Non-taster AVI/AVI 45% Medium-taster AVI/PAV 25% supertaster PAV/PAV Alti livelli di variazioni alleliche sono state trovate all’interno dei loci TAS2R nelle popolazioni umane. Questa variabilità correla con l’enorme variabilità nella percezione di composti amari riscontrata nell’uomo. Le diversità nei geni TAS2R potrebbero essere dovuti alla selezione naturale, che può aver favorito alleli maggiormente responsivi a tossine naturali amare prodotte dalle piante.

21 Beatrice Zanini Polimorfismo rs o A262V Abbiamo detto che tre SNPs del gene TAS2R38 determinano tre sostituzioni aminoacidiche nelle posizioni P49A, A262V e V296I. Il secondo e il terzo sono in perfetto linkage disequilibrium, quindi gli alleli segregano insieme. Noi studieremo il terzo 1.ctttctgca ctgggtggca accaggtctt tagattagcc aactagagaa gagaagtaga 61 atagccaatt agagaagtga catcatgttg actctaactc gcatccgcac tgtgtcctat 121 gaagtcagga gtacatttct gttcatttca gtcctggagt ttgcagtggg gtttctgacc 181 aatgccttcg ttttcttggt gaatttttgg gatgtagtga agaggcaggc actgagcaac rs G/C 241 agtgattgtg tgctgctgtg tctcagcatc agccggcttt tcctgcatgg actgctgttc 301 ctgagtgcta tccagcttac ccacttccag aagttgagtg aaccactgaa ccacagctac 361 caagccatca tcatgctatg gatgattgca aaccaagcca acctctggct tgctgcctgc 421 ctcagcctgc tttactgctc caagctcatc cgtttctctc acaccttcct gatctgcttg 481 gcaagctggg tctccaggaa gatctcccag atgctcctgg gtattattct ttgctcctgc 541 atctgcactg tcctctgtgt ttggtgcttt tttagcagac ctcacttcac agtcacaact 601 gtgctattca tgaataacaa tacaaggctc aactggcaga ttaaagatct caatttattt 661 tattcctttc tcttctgcta tctgtggtct gtgcctcctt tcctattgtt tctggtttct 721 tctgggatgc tgactgtctc cctgggaagg cacatgagga caatgaaggt ctataccaga 781 aactctcgtg accccagcct ggaggcccac attaaagccc tcaagtctct tgtctccttt 841 ttctgcttct ttgtgatatc atcctgtgct gccttcatct ctgtgc ccct actgattctg rs C/T 901 tggcgcgaca aaataggggt gatggtttgt gttgggataa tggcagcttg tccctctggg 961 catgcagcca acctgatctc aggcaatgcc aagttgagga gagctgtgat gaccattctg rs A/G 1021 ctctgggctc agagcagcct gaaggtaaga gccgaccaca aggcagattc ccggacactg 1081 tgctgagaat ggacatgaaa tgagctcttc attaatacgc ctgtgagtct tcataaatat 1141 gcc

22 Beatrice Zanini TTTTTAGCAG ACCTCACTTC ACAGTCACAA CTGTGCTATT CATGAATAAC AATACAAGGC TCAACTGGCA GATTAAAGAT CTCAATTTAT TTTATTCCTT TCTCTTCTGC TATCTGTGGT CTGTGCCTCC TTTCCTATTG TTTCTGGTTT CTTCTGGGAT GCTGACTGTC TCCCTGGGAA GGCACATGAG GACAATGAAG GTCTATACCA GAAACTCTCG TGACCCCAGC CTGGAGGCCC ACATTAAAGC CCTCAAGTCT CTTGTCTCCT TTTTCTGCTT CTTTGTGATA TCATCCTGTG Y TGCCTTCATC TCTGTGCCCC TACTGATTCT GTGGCGCGAC AAAATAGGGG TGATGGTTTG TGTTGGGATA ATGGCAGCTT GTCCCTCTGG GCATGCAGCC ATCCTGATCT CAGGCAATGC CAAGTTGAGG AGAGCTGTGA TGACCATTCT GCTCTGGGCT CAGAGCAGCC TGAAGGTAAG AGCCGACCAC AAGGCAGATT CCCGGACACT GTGCTGAGAA TGGACATGAA ATGAGCTCTT CATTAATACG CCTGTGAGTC TTCATAAATA TGCCTCTGAT TCTTCAGGAA TACAACTCTG rs C/T

23 Beatrice Zanini PCR 1° step: denaturazione

24 Beatrice Zanini 5’ 3’ 5’ 3’ Foward Reverse 28 bp Amplimero 2°step: annealing 3° step: extension PCR

25 Beatrice Zanini PCR allele-specifica per rs C/T T Mismatch PCR --->F outer ---  5’ ________ G ________ 3’ ______ G_____ Allele C 3’ _________C ________ 5’ ______ C_____ 125 bp C  -- R inner F inner ----->T 5’ ____ ___ T _________ 3’ _____ T _______ Allele T 3’ _______ A _________ 5’ _____ A _______ 177 bp C Mismatch  -- R outer

26 Beatrice Zanini Gel Elettroforesi CC C/T TT 247 bp 177 bp 125 bp

27 Beatrice Zanini Il linkage disequilibrium (LD) indica la presenza di associazione preferenziale tra specifici alleli relativi a due o pi ù loci, presenti sullo stesso cromosoma, che costituiscono di solito un particolare aplotipo ancestrale, diffuso nella popolazione in cui è rilevato, perch è trasmesso lungo la discendenza da un comune progenitore. Se consideriamo due loci polimorfici situati sullo stesso cromosoma, ci aspettiamo che i loro alleli vengano ereditati insieme (cioè co-segregano) in base alla distanza che intercorre tra loro sul cromosoma. Più grande è la loro distanza, più è facile che un evento di crossing over separi i due alleli. C T/C G A C T A A/G G  SNP SNP

28 Beatrice Zanini Questi due SNPs danno 4 aplotipi C T G A C T A A G C C G A C T A G G C T G A C T A G G C C G A C T A A G Nel gene TAS2R38 potremo avere: 1°. TT AA omozigote per il polimorfismo ==> Non taster 2°. CC GG omozigote wt ==> Taster 3: CT GA eterozigote ==> Taster

29 Beatrice Zanini


Scaricare ppt "TAS2R38 Bitter Receptor Gene LA VARIAZIONE GENETICA ASSOCIATA ALLA PERCEZIONE DEL GUSTO AMARO."

Presentazioni simili


Annunci Google