La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

I LEZIONE PARTE B Lavorare con le sequenze nucleotidiche: Formato FASTA Traduzione Mascheramento Inverso complementare (Utilizzo di BCM sequence utilities)

Presentazioni simili


Presentazione sul tema: "I LEZIONE PARTE B Lavorare con le sequenze nucleotidiche: Formato FASTA Traduzione Mascheramento Inverso complementare (Utilizzo di BCM sequence utilities)"— Transcript della presentazione:

1 I LEZIONE PARTE B Lavorare con le sequenze nucleotidiche: Formato FASTA Traduzione Mascheramento Inverso complementare (Utilizzo di BCM sequence utilities)

2 ANALISI DI SEQUENZE IL FORMATO FASTA una sola linea di descrizione che inizia con “>” poi la sequenza, senza spazi, linee vuote, e caratteri “strani”. solo caratteri che seguano il codice IUB/IUPAC per gli aminoacidi e gli acidi nucleici il “–” indica un gap >gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTK QESKPVQMMCMNNSFNVATLPAEKMKILELPFASGDLSMLVLLPDEV SDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSV LMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAG STGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP

3 Codice per gli acidi nucleici: A --> adenosine M --> A C (amino) C --> cytidine S --> G C (strong) G --> guanine W --> A T (weak) T --> thymidine B --> G T C (not A) U --> uridine D --> G A T (not C) R --> G A (purine) H --> A C T (not G) Y --> T C (pyrimidine)V --> G C A (not T) K --> G T (keto) N --> A G C T (any) - gap of indeterminate length IL FORMATO FASTA

4 Codice per gli aminoacidi: A alanine P proline B aspartate or asparagine Q glutamine M methionine N asparagine C cystine R arginine D aspartate S serine E glutamate T threonine F phenylalanine U selenocysteine G glycine V valine H histidine W tryptophan I isoleucine Y tyrosine K lysine Z glutamate or glutamine L leucine X any * translation stop IL FORMATO FASTA

5 ANALISI DI SEQUENZE Uso di BCM ReadSeq per la conversione in formato FASTA Uso di BCM Reverse Complement, per fare l’inverso complementare di una sequenza

6 TRADUZIONE Il codice genetico: senza sovrapposizione  triplette  codoni 20 amminoacidi e 4 nucleotidi  4, 4 2, 4 3 =64  piu’ parole del necessario  degenerazione (tutti i codoni hanno un significato  alcuni aa sono specificati da piu’ codoni). Da 1 a 6 codoni per aa. Vacillamento nella terza posizione. Codoni di STOP: UAG, UGA e UAA

7 6 Frame Translation - translates a nucleic acid sequence in 6 frames (BCM) 6 The STANDARD Genetic Code Serina Codone tRNAanticodone UCU o UCC tRNAser1AGG + vacillamento UCA o UCG tRNAser2AGU + vacillamento AGU o AGC tRNAser3UCG + vacillamento TRADUZIONE

8 Diversi codici genetici Codice genetico mitocondriale di animali AUA  Met invece di Ile UGA  Trp invece di STOP AGA e AGG  STOP invece di Arg (UAA, UAG, AGA, AGG) Altri codici in micoplasmi, protozoi e funghi. Uso di BCM 6 frames translation per la traduzione di sequenze nucleotidiche TRADUZIONE

9 MASCHERAMENTO Piu’ del 25% del genoma degli eucarioti e’ formato da DNA altamente ripetitivo DNA ripetitivo:  DNA ripetuto in tandem  DNA ripetuto intersperso

10 MASCHERAMENTO Major classes of tandemly repeated human DNA: Class Size of repeat Major chromosomal location(s) ‘Megasatellite' DNA several kb Various locations on selected (blocks of hundreds of chromosomes kb in some cases) Satellite DNA 5–171 bp Especially at centromeres (blocks often from 100 kb to several Mb in length) Minisatellite DNA 6–64 bp At or close to telomeres of all (blocks often within chromosomes the 0.1–20 kb range) Microsatellite DNA 1–4 bp Dispersed throughout all (blocks often less than 150 bp) chromosomes

11 MASCHERAMENTO Il DNA ripetuto intersperso si origina per ricombinazione o, soprattutto per trasposizione. La maggior parte dei trasposono sono retrotrasposoni, che, nei mammiferi, includono: LINEs (long interspersed nuclear elements) Elementi LINE-1 nell’uomo ed in altri mammiferi. SINEs (short interspersed nuclear elements) Alu repeat, una ogni circa 3 Kb nel genoma umano, anche Alu trascritte. La sequenza delle ripetizioni e’ specie-specifica o lineage- specifica Primati: alpha satellite 340 basi

12 MASCHERAMENTO Uso di RepeatMasker per il mascheramento di sequenze genomiche


Scaricare ppt "I LEZIONE PARTE B Lavorare con le sequenze nucleotidiche: Formato FASTA Traduzione Mascheramento Inverso complementare (Utilizzo di BCM sequence utilities)"

Presentazioni simili


Annunci Google