La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

ALLINEAMENTO DI SEQUENZE Procedura per comparare due o piu’ sequenze, volta a stabilire un insieme di relazioni biunivoche tra coppie di residui delle.

Presentazioni simili


Presentazione sul tema: "ALLINEAMENTO DI SEQUENZE Procedura per comparare due o piu’ sequenze, volta a stabilire un insieme di relazioni biunivoche tra coppie di residui delle."— Transcript della presentazione:

1

2 ALLINEAMENTO DI SEQUENZE Procedura per comparare due o piu’ sequenze, volta a stabilire un insieme di relazioni biunivoche tra coppie di residui delle sequenze considerate che massimizzino la similarita’ tra le sequenze stesse L’allineamento tra due sequenze biologiche è utile per scoprire informazione funzionale, strutturale ed evolutiva

3 Cosa vuol dire allineare due sequenze (proteine o acidi nucleici)? Scrivere due sequenze orizzontalmente in modo da avere il maggior numero di simboli identici o simili in registro verticale anche introducendo intervalli (gaps – inserzioni/delezioni – indels) seq1: TCATG seq2: CATTG TCAT-G.CATTG 4 caratteri uguali 1 inserzione/delezione

4 ALLINEAMENTO DI SEQUENZE A COPPIE AGTTTGAATGTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC ||||||||||||||||||| |||||||| ||| | |||||| ||||||||||||||||| AGTTTGAATGTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC MULTIPLO KFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl KYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKT- KFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl KFKHHLKEHIRIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV KYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTs

5 Allineamento GLOBALE o LOCALE GLOBALE: considera la similarita’ tra due sequenze in tutta la loro lunghezza LOCALE: considera solo specifiche REGIONI simili tra alcune parti delle sequenze in analisi Globale LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||. | | |.|.| || || | || TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHKAG Locale LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||||||||.|||| TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHK ALLINEAMENTO GLOBALE ALLINEAMENTO LOCALE

6 ALGORITMI PER L’ALLINEAMENTO DI SEQUENZE Algoritmo di Needleman & Wunsch  allineamento globale Algoritmo di Smith & Waterman  allineamento locale

7 MISURE DI IDENTITA’ E DI SIMILARITA’ Il modo piu’ semplice per definire le relazioni di similarita’ tra nucleotidi e’ basato solo su IDENTITA’ e DIVERSITA’. La piu’ semplice matrice di similarita’ per i nucleotidi e’ la “UNITARY SCORING MATRIX”, matrice che assegna punteggio 1 a coppie di residui identici e 0 ai mismatches. A C G T A | C | G | T | Possono esserci altri criteri per dare un peso diverso da zero a matches tra residui non identici (ad.es. pesare in modo diverso transizioni e transversioni)

8 MISURE DI IDENTITA’ E DI SIMILARITA’ E’ possibile misurare la similarita’ tra aminoacidi tenendo conto delle loro proprieta’ chimico-fisiche ad. es. l’ acido glutammico e’ piu’ simile all’acido aspartico che alla fenilalanina Un altro modo per misurare la similarita’ tra aminoacidi e’ fondato sulle frequenze osservate di specifiche sostituzioni aminoacidiche in opportuni gruppi di allineamenti. La similarita’ tra due specifici aminoacidi, diciamo A e G, e’ proporzionale alla frequenza con cui si osserva la sostituzione A->G. Le MATRICI DI SOSTITUZIONE piu’ conosciute ed utilizzate sono le matrici PAM (o Dayhoff Mutation Data (MD) Matrices) e le matrici BLOSUM.

9 Matrici di sostituzione Le matrici di sostituzione si basano su evidenze biologiche Le differenze che si osservano tra sequenze omologhe negli allineamenti sono riconducibili ad eventi di mutazione Alcune di queste mutazioni hanno effetti trascurabili sulla struttura/funzione della proteina ARNK A5-2 R-7 3 N--70 K---6

10 RICERCA DI SIMILARITÀ SIMILARITA’  ?  OMOLOGIA OMOLOGIA proprieta’ di caratteri (sequenze) dovuta alla loro derivazione dallo stesso antenato comune SIMILARITA’ “grado” di somiglianza tra 2 sequenze La similarita’ osservata tra due sequenze PUO’ indicare che esse siano omologhe, cioe’ evolutivamente correlate La similarita’ e’ una proprieta’ quantitativa, si puo’ misurare L’omologia e’ una proprieta’ qualitativa, non si puo’ misurare. La similarita’ tra sequenze si osserva, l’omologia tra sequenze si puo’ ipotizzare in base alla similarita’ osservata. Percentuale di similarita’ Ricerca di similarita’

11 OMOLOGIA E OMOPLASIA Omologia similarita’ dovuta a derivazione dallo stesso antenato comune Omoplasia similarita’ dovuta a convergenza, stessa pressione selettiva su due linee evolutive puo’ condurre a caratteri simili ORTOLOGIA E PARALOGIA OMOLOGIA ANTENATO COMUNE ORTOLOGIAPARALOGIA PROCESSO DI SPECIAZIONEDUPLICAZIONE GENICA Descrivo le relazioni tra geni di una famiglia intraorganismo (paralogia) o tra diversi organismi (ortologia )

12 BLAST Basic Local Alignment Search Tool (Altschul 1990) L’ algoritmo di BLAST e’ euristico e opera: 1Tagliando le sequenze da comparare in piccoli pezzi (parole) 2Ignorando tutte le coppie di parole (sequenza query/database) la cui comparazione da’ un punteggio inferiore ad un limite fissato 3Cercando di estendere tutte le hits rimanenti sino a che l’allineamento locale raggiunge un certo punteggio Dati una SEQUENZA QUERY ed un DATABASE DI SEQUENZE, BLAST ricerca nel database “parole” di lunghezza almeno “W” con un punteggio di similarita’ di almeno “T” una volta allineate con la sequenza “query” (HSP, High Scoring Pairs). Le “parole” selezionate vengono estese, se possibile, fino a raggiungere un punteggio superiore a “S” oppure un “E-value” inferiore al limite specificato.

13

14 La SIGNIFICATIVITA’ di ciascun allineamento viene definita da: - P value e’ la probabilita’ di ottenere un allineamento con punteggio uguale o migliore di quello osservato Si calcola mettendo in relazione il punteggio osservato (S) con la distribuzione attesa di HSP quando si comparano sequenze random della stessa lunghezza e composizione di quella in analisi (query sequence) Piu’ il P value e’ vicino a 0 piu’ e’ significativo (2x e’ meglio do !!!) - E value e’ il numero atteso di allineamenti con punteggio uguale o migliore di quello osservato (Piu’ e’ basso piu’ e’ buono!) ATAGGGCACTTT-GCGATGA ** * *** ** ***** ATTGCCCACGTTCGCGATCG Sequenze allineate Osservazione Ipotesi alternative OMOLOGIA? CASO? Significatività di un allineamento

15 Allineamento (matrice Blosum62, gap=-11) Seq1 V D C - C Y Seq2 V E C L C Y Score Score = 20 Sequenze randomizzate Seq1 Seq2 C D V Y C C V Y L E C Sequenze originali Seq1 Seq2 V D C C Y V E C L C Y Allineamento (matrice Blosum62, gap=-11) Seq1 Seq2 C D V Y - C C V E Y L C Score = 9 Score Score allineamento (20) Distribuzione score casuali Frequenza Score Ripetere (es volte) salvando tutti i punteggi

16

17 Usare BLAST OPZIONI Sequenza querynucleotidica proteica (sequenza in formato FASTA, GenBank Accession numbers o GI numbers) Databasedatabase di seq. nucleotidiche database di seq. proteiche ProgrammaStandard BLAST (blastn) Standard protein BLAST (blastp) translated blast (blastx, tblastn, tblastx) MEGABLAST PSI-BLAST PHI-BLAST … Blast selection table

18 Usare BLAST database di seq. nucleotidiche nr All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS, or phase 0, 1 or 2 HTGS sequences). No longer "non- redundant". est Database of GenBank+EMBL+DDBJ sequences from EST division. est_human est_mouse htgs Unfinished High Throughput Genomic Sequences yeast Saccharomyces cerevisiae genomic nucleotide sequences mito Database of mitochondrial sequences vector Vector subset of GenBank(R), NCBI, in month All new or revised GenBank+EMBL+DDBJ+PDB sequences alu Select Alu repeats from REPBASE, suitable for masking Alu repeats from query sequences. dbsts Database of GenBank+EMBL+DDBJ sequences from STS division. chromosome Searches Complete Genomes, Complete Chromosome, or contigs form the NCBI Reference Sequence project.

19 Usare BLAST PROGRAMMI Blastn Nucleotide query - Nucleotide db Blastp Protein query - Protein db Translating BLAST attraverso la traduzione concettuale della query sequence o dei database permette di comparare una sequenza nucleotidica con database di proteine o viceversa. Translated query - Protein db blastx Protein query - Translated db tblastn Translated query - Translated db tblastx MEGABLAST usa un algoritmo greedy (ingordo) veloce ed ottimizzato per comparare sequenze che differiscono poco Search for short nearly exact matches blastn con parametri scelti in modo da ottimizzare la ricerca di matches quasi esatti e brevi. Questi si trovano spesso per caso, percio’ utilizza alto E-value, piccola dimensione della parola e filtering PSI-BLAST Find members of a protein family or build a custom position- specific score matrix PHI-BLAST Find proteins similar to the query around a given pattern

20

21

22


Scaricare ppt "ALLINEAMENTO DI SEQUENZE Procedura per comparare due o piu’ sequenze, volta a stabilire un insieme di relazioni biunivoche tra coppie di residui delle."

Presentazioni simili


Annunci Google