La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Gianni Colotti and Andrea Ilari Istituto di Biologia e Patologia Molecolari del CNR e Dip. Scienze Biochimiche Sapienza Università di Roma Gli enzimi della.

Presentazioni simili


Presentazione sul tema: "Gianni Colotti and Andrea Ilari Istituto di Biologia e Patologia Molecolari del CNR e Dip. Scienze Biochimiche Sapienza Università di Roma Gli enzimi della."— Transcript della presentazione:

1 Gianni Colotti and Andrea Ilari Istituto di Biologia e Patologia Molecolari del CNR e Dip. Scienze Biochimiche Sapienza Università di Roma Gli enzimi della via del tripanotione, buoni target per progettare nuovi farmaci contro la Leishmaniosi e le Tripanosomiasi.

2 Leishmaniosi 2 milioni di nuovi casi ogni anno morti/anno (superati solo dalla malaria) La leishmaniosi viscerale: Causa la morte se non trattata correttamente Leishmaniosi cutanea Provoca mutilazioni gravi e sfiguranti

3 Distribuzione geografica delle tripanosomiasi

4 Ciclo della Leishmania: la malattia è trasmessa dalla puntura dei flebotomi (pappataci) AmastigotePromastigoti

5 Ciclo di vita del Tripanosoma cruzi: malattia di Chagas, Tripanosomiasi americana : morti/anno

6 Ciclo di vita del Tripanosoma brucei :malattia del sonno Tripanosomiasi africana: morti/anno

7 Eflornitina è un inibitore irreversibile dell’ornitina decarbossilasi (ODC), agisce in maniera specifica solo sull’ODC della malattia del sonno africana (causata dal tripanosoma brucei gambiense) Melarsoprol I è un farmaco che contiene arsenico ed è pertanto molto tossico, inibisce la piruvato chinasi ed altre proteine che contengono I tioli. E’ attiva contro tutte le tripanosomiasi Medicine contro le tripanosomiasi Pentamidina è una poliammina che inibisce l’ ODC e la spermidina sintasi (SpdS),

8  Le medicine più usate da oltre 70 anni sono gli antimoniali che però sono tossici e hanno sviluppato resistenze in alcune regioni endemiche (Bihar, India) Leishmaniosi Ci sono altri farmaci sviluppati per altre patologie:  Anfotericina B, un farmaco antifungino. E’ stata studiata una nuova formulazione basata sui liposomi che rende il farmaco più solubile (AmBisome).  Miltefosina (2-(esadeossi-ossido-fosforil)ossietil-trimetil-azanio): farmaco sviluppato contro il cancro.  Paromomicina: antibiotico, inibisce la sintesi proteica legandosi all’ RNA ribosomiale Tutti questi farmaci sono altamente tossici, presentano effetti collaterali e soprattutto SONO COSTOSI. C’è un bisogno urgente di sviluppare nuovi farmaci contro la leishmaniosi che siano meno tossici ed abbiano costi sostenibili per i paesi poveri dove la malattia si sviluppa.

9 Antimoniali Farmaci più usati contro la leishmaniosi: Pentostam: sodio stibogluconato Glucantime: meglumina antimoniato Gli antimoniali pentavalenti agiscono come profarmaci e richiedono la riduzione dell’Sb(V) a Sb (III) che è biologicamente attivo. Prima dei nostri studi il meccanismo d’azione molecolare di questi farmaci non era stato ancora scoperto. Colotti and Ilari, Antimony-based Therapy of Leishmaniases, Molecular and cellular Rationale. Encyclopedia of Metalloproteins, Ed. Kretsinger, 2013

10 Cosa fanno gli antimoniali ? Colotti and Ilari, Antimony-based Therapy of Leishmaniases, Molecular and cellular Rationale. Encyclopedia of Metalloproteins, Ed. Kretsinger, 2013 Sb(III): diminuisce le difese del parassita contro l’acqua ossigenata che è prodotta dai macrofagi durante l’infezione. Le difese del parassita diminuiscono perchè diminuisce la concentrazione del: TRIPANOTIONE

11 E’ formato da due molecole di glutatione e una di spermidina che le tiene insieme. La forma attiva è quella ridotta. E’ usato dagli enzimi tryparedoxin/tryparedoxin peroxidase per neutralizzare l’acqua ossigenata prodotta dai macrofagi del nostro sistema immunitario. Senza il tripanotione i parassiti vengono facilmente eliminati dal sistema immunitario dell’ospite Forma attiva Cos’ è il tripanotione?

12 2 Glutatione + Spermidina T[SH] 2 Trypanothione synthetase T[S] 2 Trypanothione reductase Tryparedoxin peroxidase TXN[SH] 2 TXN[S] 2 ROOH ROH + H 2 O Metabolismo del tripanotione Colotti, Ilari, Polyamine metabolism in Leishmania: from arginine to trypanothione, Amino Acids Tripanotione Gli enzimi del metabolismo del tripanotione sono dei buoni bersagli molecolari per la progettazione di nuovi farmaci perchè sono essenziali per il parassita e unici (non sono presenti nrll’ospite).

13 Devo trovare delle molecole che inibiscono gli enzimi Della via del tripanotione attraverso il “Drug Design” Ricerca di base: 1. Devo conoscere la struttura delle proteine della via del tripanotione per poterne studiare la funzione attraverso tecniche quali la cristallografia ai raggi X 2. Devo sapere come funzionano usando tecniche di cinetica enzimatica in vitro 3. Devo trovare il modo di inibirle perché in questo modo uccido il parassita: 4.Posso usare banche dati per fare screening bio-informatici (HTD) 5.Posso fare test di inibizione 6.Posso “vedere” la struttura delle proteine legate agli inibitori 7.Posso usare le informazioni ottenute per sintetizzare inibitori ancora più efficaci Ricerca pre-clinica: 1. Test sui parassiti 2. Test di ”in vivo” sui modelli animali 3. Test di tossicità

14 FAD binding domain NADPH binding domaininterface domain FAD N-terminus C-terminus Struttura ottenuta mediante diffrazione ai raggi X di TR

15 NADPH FAD Trypanothione H461’ Monomer A NADPH, FAD, e le due cisteine (C52, C57). C57 C52 TR ha tre centri redox per ridurre il tripanotione

16 NADPH FAD C 52 C 57 H 461 Sb pdb: 2w0h La costante di inibizione misurata è K i : 1.5 ± 0.4 μM un valore che indica un’alta inibizione Sb(III) il principio attivo degli antimoniali inibisce TR Baiocco P, Colotti G, Franceschini S, Ilari A. Molecular basis of antimony treatment in leishmaniasis. J. Med. Chem. (2009) 52(8):

17 L’argento si lega al sito attivo Come l’antimonio Ag inibisce TR con alta efficienza Ag(I): Ki = 50 nM Ag(0): Ki = 500 nM Baiocco, Ilari, Di Muccio, Gramiccia, Messori, Colotti, Inhibitory Effect of Silver Nanoparticles on Trypanothione Reductase Activity and Leishmania infantum Proliferation, ACS Med Chem Lett, 2, , (2011). Promastigote IC50=2.18 µM amastigote IC50=1.76 µM

18 La ferritina di P. furiosus è un buon “drug carrier” : 1. È in grado di sintetizzare nanoparticelle di argento (AgNP) a. Di dimensioni controllate (2.1 ± 0.4 nm), b. Stabili c. Solubili d. Contenenti tanti atomi di argento: 400 Ag/NP 2. E’ fagocitata dai macrofagi dove la Leishmania si concentra e si moltiplica Kasyutich O, Ilari A, Fiorillo A, Tatchev D, Hoell A, Ceci P. (2010) J Am Chem Soc. 132(10): Drug delivery: per ridurre gli effetti tossici dell’argento il rilascio del farmaco deve essere mirato

19 Auranofina è un complesso organometallico classificato dalla World Health Organization come antireumatico (brand name Ridaura). Strategia per trovare nuovi farmaci contro le “neglected diseases”: si testano farmaci già presenti in commercio L’ Auranofina inibisce TR con alta affinità (Ki= 155 nM) e uccide I promastigoti (IC 50 =9.68  M) L’ Auranofina è un inibitore competitivo di TR e la inibisce con due modalità diverse : 1.L’ Au si lega ai residui coinvolti nella catalisi. 2.Il 3,4,5-triacetossi-6- (acetilossimetil) ossano-2- tholato. si lega alla cavità che ospita il tripanotione Ilari, Baiocco, Messori, Fiorillo, Gramiccia, Di Muccio, Colotti; Amino Acids 2011

20 Molti complessi dell’oro sono in grado di inibire TR ad una concentrazione nanomolare Colotti, Ilari et al ChemMedChem 2013, CompoundsK i (nM) IC 50 (  M) Au (III) AuCl 3 160±510.1 [(bipy)Au(OH) 2 ][PF 6 ] 40± Auoxo1 68± Au(Pbi)Cl 2 90± K[Au(Sac) 4 ] 200± [Au(NNO)Cl]25000± [Au(pyox iPr )Cl 2 ][PF 6 ] 75± [Au(pyox Bn )Cl 2 ][PF 6 ] 185± Au(III)+Au(I) [Cl 2 Au III (Pbi)Au I (PPh 3 )][ PF 6 ] 22± Au(I) Auranofin 155± K[Au(Sac) 2 ] 140± [(TPA)Au(Sac)] 50±18 8.5

21 Cosa ci si può fare con la struttura ? “Virtual screening”di banche dati e HTD CompoundGoldScor e 1 (MBP15) (MBP16) (MBP11) (MBP19) (MBP18) (MBP20) (MBP10) (MBP2) (MBP3) (MBP1)39.13 Il Virtual Screening consente di identificare famiglie di composti che meglio si adattano al sito attivo dell’enzima i) 1,5-difenill-pirroli (MBP1-7) ii) Derivati della toluidina (MBP8-10), iii) Triazoli (MBP11-15) iv) Derivati dell’imidazolo (MBP16-20)

22 Struttura cristallografica di TR in complesso con MBP15 MBP15 inibisce TR in modo competitivo (Ki =4.0±2.0  M) ci sono due conformazioni alternative MBP15 ((1-(4-etilfenil)-2- metil-5-(4-(metiltiofenil)- 1H-pirrol-3-il)metil) tiomorfolina può essere considerata come un composto base per disegnare nuovi farmaci contro la leishmaniosi

23 Determinazione della struttura molecolare di TXNPx e TXN attraverso la cristallografia ai raggi X NADPHNADP+ TR(S) 2 TR(SH) 2 Try(SH) 2 Try(S) 2 TXN(S) 2 TXNPx(SH) 2 TXN(SH) 2 TXNPx(S) 2 ROOHROH  studio della riduzione dei perossidi in Leishmania a livello moleclare  Valutazione delle perossidossine come bersagli molecolari per la progettazione di nuovi farmaci Detossificazione dai perossidi prodotti dai macrofagi

24 LmTXN CfTXN (63% of seq. id.) TbTXN (59% of seq. id.) LA DIMERIZZAZIONE AVVIENE ATTRAVERSO LO SCAMBIO DELL’ELICA N-TERMINALE Lm TXN è un omodimero

25 TXN1 possiede una regione carica negativamente Importante per l’interazione con il suo partner molecolareTXNPx Cys 40

26 Cys 52 riduce l’acqua ossigenata ad acqua La Cys 173’ attacca nucleofilicamente la Cys52 formando un ponte disolfuro che viene ridotto da TXN La struttura ai raggi X della TXNPx ci dice che la proteina è Un omodimero funzionale Cys173’ Cys52

27 La triparedossina perossidasi è un decamero TXNPx possiede una regione superficiale carica positivamente vicina al sito attivo TXNPX è un decamero Fiorillo et al., PLOS Negl. Dis., 2012,

28 Modello di interazione tra TXN e TXNPx ch consente ai siti attivi degli enzimi di venire a contatto

29 High-throughput docking: scoperta dei primi inibitori non covalenti di TXNPx Composto 12 inibisce TXNPx non covalentemente CpdsR1R1 R2R2 R3R3 HRP inhib.(ΔA/ΔA 0 )  100 a KD(µM) 1HF6,7-diOMeNo47 ± 6%290 ± 13 2NO 2 F6,7-diOMeNo15 ± 4%172 ± 6 3NH 2 F6,7-diOMeNo44 ± 6%354 ± 12 4NMe 2 F6,7-diOMeNd 156 ± 5 5IF6,7-diOMeNo71 ± 6%281 ± 11 6PhF6,7-diOMeNo75 ± 9% 52 ± 1 7HF6-OMeNo55 ± 6% 47 ± 1 8HFHNo38 ± 8%104 ± 4 9HH6,7-diOMeYes- 74 ± 3 10HCl6,7-diOMeYes- 63 ± 3 11HBr6,7-diOMeNo12 ± 7%112 ± No93 ± 6% 39 ± 1 KD misurate con la SPR

30 Conclusioni 1. Le strutture di TR e TR-Sb III hanno consentito di capire il meccanismo di azione degli antimoniali 2. Gli esperimenti con complessi di Ag e Au hanno consentito di capire che questi metalli hanno la capacità di inibire l’enzima (Ki (Ag(I)= 50 nM, Ki (auranofin) =155 nM vs. 1.5 µM). 4.Le strutture di TXN e TXNPx hanno consentito di capire il meccanismo d’azione di queste due proteine. 3. Tutti i metalli che sono acidi deboli di Lewis sono probabilmente in grado di inibire TR legandosi alle sue cisteine. 5. Abbiamo scoperto I primi inibitori non covalenti di TXNPx

31 La Leishmaniosi e le tripanoianosomiasi sono malattie legate alla povertà e alla denutrizione Si possono sfruttare le conoscenze acquisite dalla ricerca di base per progettare Novi farmaci solo attraverso forti investimenti pubblici

32 Ringraziamenti: Istituto di Biologia e Patologia Molecolari – CNR Dipartimento di Scienze Biochimiche - Università Sapienza Roma Gianni Colotti Paola Baiocco Annarita Fiorillo Pierpaolo Ceci Alberto Boffi Francesco Malatesta Istituto Superiore di Sanità Marina Gramiccia Trentina di Muccio Università di firenze Luigi Messori Sapienza Università di Roma Mariangela Biava Università di Siena Giuseppe Campiani Sandra Gemma

33 Eflornithine is an irreversible inhibitor of ornithine decarboxylase (ODC). eflornithine is effective only for West African sleeping sickness(caused by Trypanosoma brucei gambiense); it has no effect on East African sleeping sickness (caused by Trypanosoma brucei rhodesiense). Melarsoprol is a very toxic, arsenic-based drug against all Trypanosomiases. It inhibits the pyruvate kinase and other thiol proteins. Drugs against trypanosomiases Pentamidine is a polyamine. It inhibits ODC activity and spermidine synthase (SpdS), and putrescine and Spd transport

34 Structure-based screening of azole- based compounds as inhibitors of Trypanothione Reductase i) 1,5-di-phenyl-pyrroles (1-7) ii) toluidine derivatives (8-10), iii) triazolyl derivatives (11-15) iv) imidazolyl derivatives (16-20)

35 Cytosolic Tryparedoxin and Tryparedoxin peroxidase are essential and unique. Trypanosomatides lack catalase and the classical selenium-containing glutathione peroxidase. Several TpxPxs; the most important (essential) is TpxPx1 (cytosolic): Broad spectrum peroxidase, acts on hydroperoxide and organic hydroperoxides. Also chaperone activity. TpxPx1: completely different with respect to mammalian peroxidases (unique) Active site:VCPTEICQ

36 Crystallization and protein structure of oxidized TR and reduced TR in complex with NADPH and Sb(III) Baiocco P, Franceschini S, Ilari A, Colotti G. Protein Pept Lett. 2009;16(2): The structures of oxidized TR and of reduced NADPH- and Sb(III)-bound TR are very similar, the superposition between the two structures yielding a rmsd of Å. The most important differences are visible: in the catalytic site in the NADPH binding site

37 TR L.Infantum GPPLFAALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEMDRESLCPNWKTLIAAKN 120 GR human -----HKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFN--WRVIKEKRD 104 **************:*. * : :::::..:*:..: *:.: :: Glutathione reductase Trypanothione reductase Leishmania TR vs human GR Fairlamb et al., 2004

38 In the oxidized TR structure, the two sulfur atoms of Cys52 and Cys57 form a disulfide bond Upon protein reduction by NADPH the bridge breaks, the sulfur atoms move away, to a distance of 4.4 Å Sb(III) is tetrahedrically coordinated by the two cysteines (Cys52, Cys57), Thr335 and His461' of the two-fold symmetry related subunit. Sb(III) binds to the catalytic site of TR Cys52 Thr335 Cys57 His461’ Thr335 His461’ Colotti et al., MR Med Chem, 2012

39 TXN1 interacts with TXNPx TXN/TXNPx catalyze the reduction of H 2 O 2 to water. This implies the interaction between the two proteins. Biacore: very strong interaction: K D =1 µM Very slow k off Interaction is dependent on the redox state. A: TXN and TXNPx in mixed redox state; full oxidation or reduction (B) weaken the interaction.

40 Crystal structure of TR with trypanothione and NADPH Baiocco et al., submitted

41 Trypanothione reductase is a homodimer: we solved TR X-ray structure in reduced state in complex with Sb(III) and NADPH and in oxidized state The inteface is very stable and is formed mostly by the residues (the “interface domain”). The two catalytic sites are placed at the dimeric interface. Experiments of size exclusion chromatography show that the L. infantum TR has a molecular weight of 105 ± 8 kDa, corresponding to a dimer

42 Samplek CAT (s -1 ) K M (mM) k CAT / K M (mM -1 s -1 ) TR11.4 ± ± ± 0.02 TR + 10 mM c ± ± ± 0.01 TR + 30 mM c ± ± ± 0.01 MBP15 inhibits TR

43

44 Lm Tryparedoxin Peroxidase (TXNPx) SH TXN S It is a 2-Cys peroxiredoxin obligate homodimer TXNPX in FF conformationTXNPX in LU conformation Cp Cr’ Cp Cr’


Scaricare ppt "Gianni Colotti and Andrea Ilari Istituto di Biologia e Patologia Molecolari del CNR e Dip. Scienze Biochimiche Sapienza Università di Roma Gli enzimi della."

Presentazioni simili


Annunci Google