La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Sindromi mieloproliferative croniche Ph neg 28/04/2015 Dr.ssa Elena Elli - Ematologia Ospedale S. Gerardo Monza.

Presentazioni simili


Presentazione sul tema: "Sindromi mieloproliferative croniche Ph neg 28/04/2015 Dr.ssa Elena Elli - Ematologia Ospedale S. Gerardo Monza."— Transcript della presentazione:

1 Sindromi mieloproliferative croniche Ph neg 28/04/2015 Dr.ssa Elena Elli - Ematologia Ospedale S. Gerardo Monza

2 Sindromi mieloproliferative croniche (SMPc) Malattie che originano dalla trasformazione neoplastica della cellula staminale pluripotente e sono caratterizzate dalla proliferazione clonale di uno o più progenitori emopoietici nel midollo osseo o in sedi extramidollari NB: Una malattia ematologica si definisce clonale se la proliferazione cellulare prende origine da un unico progenitore malato

3

4 Leucemia mieloide cronica [Ph+, t(9;22)(q34,q11), BCR-ABLpositiva] Leucemia cronica a neutrofili (CNL) Leucemia cronica a eosinofili (CEL) e sindrome ipereosinofila (HES) Policitemia vera Mielofibrosi idiopatica (con emopoiesi extramidollare) Trombocitemia essenziale Malattie mieloproliferative croniche inclassificabili Leucemia mielomonocitica cronica (CMML) Leucemia mieloide cronica atipica (aCML) Leucemia mielomonocitica giovanile (JMML) Malattie mielodisplastiche/mieloproliferative inclassificabili Classificazione WHO 2001 Sindromi mielodisplastiche/mieloproliferative Sindromi mieloproliferative

5 INCIDENCE OF PH NEGATIVE MPDs Annual Incidence / 100,000 Population Polycythemia Vera 2.8 Essential Thrombocythemia 1.5 Idiopathic Myelofibrosis 0.4 Multiple Myeloma 5.5 Chronic Myeloid Leukemia 1.6 Kutti J., Ridell B. Epidemiology of the myeloproliferative disorders: essential thrombocythemia, polycythemia vera and idiopathic myelofibrosis. Pathol Bio 2002; 49:

6 PREVALENCE OF POLYCYTHEMIA VERA AND ESSENTIAL THROMBOCYTHEMIA Disorder PV ET Prevalence 300 cases / 1 x 10 6 persons 400 cases / 1 x 10 6 persons Ruggeri, M. et al Ann Intern Med 2003: 139:

7 Cosa ci ha portato di nuovo il 2005 sulle SMPc?

8 Scoperta mutazione V617F gene JAK2

9 FFEAASMMSQLSHKHLVLNYGVCVCGEENILVQEFV FFEAASMMSQLSYKHLVLNYGVCVCGEENILVQEYV Hs Cf Mm Rn Gg FERM SH2 JH2 Kinase JAK2 V617F (esone 14 cromosoma 9) Mutazione FFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFV Baxter et al Lancet 2005

10 . Il gene JAK2 codifica per una proteina di 1132 aa che è proteina membro della JANUS KINASES FAMILY  tirosin-kinasi citoplasmatiche che funzionano da intermediari tra recettori (R) di membrana e molecole di signaling intracellulari JAK2 è constitutivamente associata al dominio citosolico di alcuni R (EPO-R, TPO-R) Jak2 prima si lega al dominio citosolico di EPO-R a livello del reticolo endoplasmatico, facilitando il corretto folding del recettore e il suo trasferimento a livello della membrana cellulare L’attivazione cellulare normalmente avviene quando il legame di un ligando (EPO; TPO) al proprio R induce lo shift dalla conformazione inattiva (dimeri separati) a quella attiva (dimeri avvicinati). Questo consente la autofosforilazione di JAK2 che, fosforilate, a loro volta, fosforilano i domini citosolici (tirosinasi) di R, che diventano siti di attacco per le molecole signaling (STATs) STATs fosforilate a loro volta da JAK2 a livello domini SH2 dimerizzano e traslocano nel nucleo dove agiscono da fattori trascrizionali JAK-STAT signaling Pathway Rawlings, J Cell Science Goldman, NEJM Hoffman, ASH 2005

11 JAK2 signaling CELLULE NORMALI Panel A: attivazione fisiologica di JAK2 da parte EPO STATs Fattori trascrizionali: entrano nel nucleo dove si legano a specifiche seq regolatrici di geni target (fdc) Pattern of proliferation, survival and differentiation of erythroid progenitors SOCS, CIS (regolatori negativi) e SHP1 (fosfatasi) Signaling negativo

12 La mutazione è localizzata a livello della valina 617 nel dominio pseudochinasicio JH2. Tale mutazione V617F è responsabile di una attivazione costitutiva della chinasi, interferendo con l’attività inibitoria del dominio JH2 Mutazione JAK2 (V617F) Individuazione della mutazione somatica V617F nelle cellule mieloidi (linea eritroide, granulocito-macrofagica, megacariocitica) allo stato eterozigote o omozigote. -Gain-of-function mutation  proteina mutata viene inattivata in minor misura e quindi transduce più efficientemente il segnale indotto dal legame dei fdc ai loro specifici R, con minor apoptosi cellule emopoietiche -Perdita di controllo della produzione cellulare e una attivazione delle cellule ematiche mature, rilevante nel determinare il fenotipo clinico delle SMP croniche Rawlings, J Cell Science Goldman, NEJM Hoffman, ASH 2005

13 Panel B/C: attivazione constitutiva di JAK2(V617F) a livello EPOR (B) e altri “cytokine receptors” (C), indipendentemente dal ligando  attivazione constitutiva di STAT5, Map-k, PL-3-k, Akt STATs Fattori trascrizionali: entrano nel nucleo dove si legano a specifiche seq regolatrici di geni target (fdc) Pattern of proliferation, survival and differentiation of erythroid progenitors SOCS, CIS (regolatori negativi) e SHP1 (fosfatasi) Signaling negativo JAK2 signaling in MPD

14 La mutazione è stata individuata in forma più frequentemente eterozigote, talora come omozigote Il meccanismo alla base della forma omozigote è + spesso quello della ricombinazione mitotica Mutazione JAK2 (V617F) La mutazione è stata riscontrata in colonie granulocito-macrofagiche ed eritroidi. I linfociti T sono WT  mutazione somatica acquisita La mutazione V617F non è un polimorfismo (assente controlli sani)

15 Frequenza della mutazione JAK2 V617F Numero% positivi PV7397 ET5157 IMF1650 MDS/AML1105 CML901 Normali900 Carcinoma/ sarcoma 4150 Baxter et al Lancet 2005; Scott et al Blood 2005

16 Genotype of individual BFU-E “Heterozygous” PV patients Percentage HomoHetero WT “Heterozygous” ET patients Scott et al Blood 2005

17 Two-step model for role of JAK2 (V617F) in clonal evolution MPD Cazzola, Haematologica 2006

18 Relazione tra differenti stadi di SMPc and JAK2 (V617F) mutation status - Una piccola proporzione di alleli mutati può essere associata afenotipo variabile (in primis trombocitosi) - Una quota di alleli mutati tra 25-50% si associa a fenotipo policitemico - La transizione da etero a omozigosi per JAK2 (V617F) si associa a evoluzione dalla fase policitemica a quella fibrotica di malattia, caratterizzata dalla constitutiva mobilizzazione di SC in PB La progressione da eterozigosi a omozigosi x JAK2 (V617F) rappresenta un importante step nella progressione della malattia in SMPc Importanza PCR-quantitativa  fornisce gradiente di espressione allele mutato che può condizionare significato clinico mutazione stessa Cazzola, Haematologica 2006

19

20 Nuova classificazione WHO 2008 neoplasie mieloidi Acute myeloid leukemia Myelodysplastic syndromes (MDS) Myeloproliferative neoplasms (MPNs) MDS/MPN –Chronic myelomonocytic leukemia –Juvenile myelomonocytic leukemia –Atypical chronic myeloid leukemia –MDS/MPN unclassifiable Myeloid neoplasms associed with eosinophilia and abnormalities of PDGFRa, PDGFRb, FGFR1 MPD Tefferi et al. Leukemia 2008

21 CML (Chronich myeloid leukemia) PV (polycythemia Vera) ET (Essential thrombocythemia) MMM (primary myelofibrosis) CNL (chronic neutrophilic leukemia) CEL (chronic eosinophilic leukemia) HES (hyperosinophilic syndrome) Mast cells disease MPNs unclassifiable Nuova classificazione WHO 2008 neoplasie mieloproliferative (MPN) Tefferi et al. Leukemia 2008

22 CRITERI DIAGNOSI MPN PH NEG WHO 2008

23 Scott. NEJM 2011 Chalignè. Leukemia 2008

24 Occorre nel 5% dei casi di POLICITEMIA VERA JAK2V617F negativa Caratteristiche alla diagnosi nei primi studi: –Pazienti più giovani –Livelli Hb più alti, GB e PLT più bassi (spesso piastrinopenia) –Alla BOM: pattern di iperplasia eritroide senza anomalie morfologiche a carico serie mieloide e megacariocitica Mutazione Esone 12 gene JAK2

25 1-4% ET 5-9% PMF

26 Mutazioni gene calreticolina Cromosoma 19 Le mutazioni sono tutte localizzate nell’esone 9 del gene Comportano un frameshift che genera una proteina con una porzione C-terminale nuova, comune alle mutazioni note fino ad oggi. Il cambiamento di sequenza della porzione C-terminale della proteina ne altererebbe la stabilità, la funzione e/o la compartimentalizzazione intracellulare Klampfl NEJM 2013

27 Klampfl NEJM 2013 Mutazioni gene calreticolina in ET/MF JAK2 negative 25% 35%

28 1.Rampal R et al, Blood 2014; 123(22):e JAK2V617F WT JAK2V617F omozigote JAK2V617F eterozigote CALR mutato Profilo di espressione genetico in accordo con il signaling attivato di JAK2 osservato in tutti i pazienti, inclusi quelli CALR mutati 1 La via JAK-STAT si attiva indipendentemente dalla mutazione driver coinvolta 0.7 Enrichment Score (ES) CALR mutatoNormale FDR qvalue= Enrichment Score (ES) EterozigoteNormale FDR qvalue= Enrichment Score (ES) WTNormale FDR qvalue= Enrichment Score (ES) OmozigoteNormale FDR qvalue= JAK2 shRNA DN Analisi Gene Supervised Enrichment: JAK2 shRNA signature enriched (vs controlli normali) nelle MPN indipendentemente dallo stato mutazionale di JAK2 Pazienti CALR-mutati: enrichment of JAK2 shRNA signature 1.Rampal R et al, Blood 2014; 123(22):e123-33

29 1. Quintas Cardama A, et al. Clin Cancer Res 2013; 19(8); 1-8; 2. Levine RL, et al. Nat Rev Cancer 2007; 7(9): ; 3. Komrokji RS, et al. Cancer Control 2012; 4. Levine RL. N Engl J Med. 2013; 369(25): ; 5. Savona MR. Leuk Res pii: S (14) doi: /leukres ; 6. Vannucchi AM. N Engl J Med.2010; 363(12): Alterazione della via JAK/STAT nella MF 6 L’attivazione costitutiva della via JAK/STAT rappresenta un’alterazione biologica comune nelle MPN Ph neg La deregolazione della via JAK/STAT può dipendere da diversi meccanismi: 2 mutazione JAK2V617F, a carico del gene JAK2 3 altre mutazioni geniche fra cui MPL e CALR 3,4 elevata concentrazione di citochine proinfiammatorie 3

30 REVISIONE CRITERI DIAGNOSI MPN PH NEG WHO 2014

31 Tefferi. Nature Reviews Clinical Oncology 2014 NUOVO ALGORITMO DIAGNOSTICO PROPOSTO per DIAGNOSI MPN PH Neg

32 Mutazioni a livello dei regolatori epigenetici e degli splicesome GenePV (%) TE (%) MF (%) Fase blastica(%) TET IDH1/ DNMT3A3-7< EZH23< ASXL SRSF2-----≈15%≈20% Identificate anche in altre neoplasie (MDS, LMA) 1 Non hanno uno specifico valore diagnostico, ma sono indicatori di neoplasia mieloide 1 Hanno una rilevanza prognostica 1 1.Vainchenker W et al, Blood. 2011; 118(7): ; 2. Vannucchi AM et al, Leukemia 2013; 27: Vannucchi AM, et al. Leukemia. 2013;27:1861-9

33 Mutazioni driver e trasformanti in MPN calreticolina

34 1.Guglielmelli P, et al. Leukemia. 2014; 28(9): Sopravvivenza globale in base al numero delle mutazioni ad alto rischio molecolare HR per l’OS per ≥2 mutazioni : 2,4 (IC 95% 1,6-3,6) No HMR1 mutazione 1,0 0,0 0,6 Anni 0,8 Sopravvivenza globale 0,4 0, p < mutazioni Nessuna mutazione Mediana 12,2 anni N=370 N=127 N=40 ≥2 mutazioni Mediana 2,6 anni 1 mutazione Mediana 7,0 anni 1.Guglielmelli P, et al. Leukemia. 2014; 28(9):

35 L’impatto negativo della presenza di >2 geni mutati sul tempo alla trasformazione blastica è stato mantenuto nella categoria di rischio basso (HR 1,8; IC 95% 0,8-4,4; p=0,061) e alto (HR 2,5; IC 95% 1,1-5,8, p=0,02) Sopravvivenza libera da leucemia in base al numero delle mutazioni ad alto rischio molecolare 1.Guglielmelli P, et al. Leukemia. 2014; 28(9): No HMR1 mutazione 1,0 0,0 0,6 Anni 0,8 Sopravvivenza libera da leucemia 0,4 0, p < mutazioni Nessuna mutazione Mediana 26,7 anni N=370 1 mutazione Mediana 11,1 anni N=127 N=40 ≥2 mutazioni Mediana 6,6 anni 1.Guglielmelli P, et al. Leukemia. 2014; 28(9):


Scaricare ppt "Sindromi mieloproliferative croniche Ph neg 28/04/2015 Dr.ssa Elena Elli - Ematologia Ospedale S. Gerardo Monza."

Presentazioni simili


Annunci Google