La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Bioinformatica Corso di Laurea specialistica in Informatica Traduzione e Proteine 23/04/2011.

Presentazioni simili


Presentazione sul tema: "Bioinformatica Corso di Laurea specialistica in Informatica Traduzione e Proteine 23/04/2011."— Transcript della presentazione:

1 Bioinformatica Corso di Laurea specialistica in Informatica Traduzione e Proteine 23/04/2011

2 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

3 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

4 Effettuata da alcuni virus a RNA chiamati retrovirus Il flusso dellinformazione genica Il dogma centrale della biologia Linformazione genica è contenuta nel DNA Questa informazione è perpetuata nelle generazioni future tramite il processo semiconservativo chiamato duplicazione del DNA Lespressione della informazione genica è invece un processo che passa attraverso un intermediario transitorio: lRNA messaggero. Questa molecola è sintetizzata sulla base di uno STAMPO sul DNA e linformazione in esso contenuta serve per dirigere la sintesi di proteine. Linformazione passa (quasi) sempre dal DNA allRNA e da questo alle proteine. DNARNAProteina TrascrizioneTraduzione Mantenimento dellinformazione Trasferimento dellinformazioneRuolo funzionale Informazione contenuta nella sequenza Informazione contenuta nella sequenza e nella quantità Informazione contenuta nella struttura e nella quantità Retrotrascrizione

5 Il flusso dellinformazione genica Il viaggio dellRNA messaggero LRNA messaggero è sintetizzato nel nucleo a partire da uno stampo di DNA. Solo un gene (eucarioti) o pochi geni (procarioti) alla volta vengono copiati su una molecola di RNA Negli eucarioti lRNA messaggero viene processato con Laggiunta del CAP al 5 Laggiunta della coda di poliA al 3 Leliminazione degli introni (splicing) LRNA maturo viene trasportato fuori dal nucleo nel citoplasma Nel citoplasma interagisci con gli organelli citoplasmatici deputati alla sintesi proteica (i ribosomi) I ribosomi sintetizzano una catena proteica lineare aggiungendo uno per uno gli aminoacidi necessari sulla base delle istruzioni contenute nella molecola di mRNA Esaurito il suo compito lmRNA viene degradato rapidamente

6 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

7 Le proteine – Natura ed informazione Le proteine sono macromolecole polimeriche. I costituenti delle proteine sono gli aminoacidi. Gli aminoacidi sono molecole caratterizzate dalla presenza di un gruppo aminico (basico) ed un gruppo acido che costituiscono la parte costante della molecola e da un residuo variabile che conferisce ad ogni aminoacido caratteristiche diverse. Il gruppo acido di un aminoacido ed il gruppo basico dellaminoacido successivo si uniscono tra loro tramite un legame covalente forte chiamato legame peptidico. La ripetizione lineare di questi legami peptidici costituisce lo scheletro della catena polipeptidica. I residui, che costituiscono la parte variabile, possono interagire tra loro. Residui appartenenti ad aminoacidi distanti tra loro possono interagire tramite legami deboli portando ad un ripiegamento della catena lineare della proteina. Queste interazioni sono alla base della struttura 3d della proteina.

8 Le proteine – Natura ed informazione Gli aminoacidi Esistono 20 diversi aminoacidi che combinati tra loro costituiscono tutte le proteine contenute negli organismi viventi. Questi aminoacidi hanno struttura chimica e proprietà diverse.

9 Le proteine – Natura ed informazione Gli aminoacidi Sulla base delle caratteristiche del loro gruppo R gli aminoacidi possono essere: Idrofobici Polari Acidi Basici Aromatici Piccoli Le interazioni tra gli aminoacidi, e quindi la struttura 3d finale della protena, saranno influenzate dalle caratteristiche chimiche degli stessi. Un aminoacido acido ed uno basico tendono ad interagire tra loro, mentre uno polare ed uno idrofobico no.

10 Le proteine – Natura ed informazione

11 Le sequenze proteiche. Linformazione Così come già visto per le sequenze di DNA o RNA, che vengono rappresentate come stringhe composte dal susseguirsi di 4 possibili caratteri che corrispondono ai 4 possibili nucleotidi, anche le sequenze proteiche possono essere rappresentate da stringhe. In questo caso i possibili aminoacidi sono 20 e di conseguenza anche lalfabeto utilizzatò nelle sequenze proteiche è costituito da (almeno) 20 caratteri. HQVKVQGCWGRWRWQEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDVGRHSL LYLKEIGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRALKHSNLLQCLAQCAEVTPYLLVMEFC PLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACGVLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYREDYFV TADQLWVPLRWIAPELVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPKPQLQL TLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPGGGGVGPGPGAAGPMLGGVVELA AASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYKWEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLSA HSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLA RDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTGEDELEEVGARRAAQRGHW RSNVSANNNSGSRCPESWDPVSAGCHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLA PAPCLVTPSWTETASSGGDHPQAEPKLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEV SAIKLASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGG YEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDS AYFSDLEAEAEATSGPEKKCGGDRAPGPELGLPSTGQPSEQVCLRPGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPS GLVPEPPEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPRAPLRLALPGLPAA LEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEEAPAVPVVVAESQSARNLRSLLKMPSLLSETFCEDL

12 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cennu sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

13 Il codice genetico La necessità di codificare linformazione Linformazione genica passa del DNA allRNA. Linformazione contenuta in queste molecole è simile, ed il meccanismo di trasmissione dellinformazione (la complementarietà delle basi) permette di copiare linformazione del DNA sullRNA utilizzando lo stesso alfabeto (con leccezione dellutilizzo dell U al posto della T) Nel passaggio da RNA a proteina il tipo di informazione cambia notevolmente. Si deve passare da un alfabeto chimico basato su 4 diversi nucleotidi ad un alfabeto chimico basato su 20 diverse aminoacidi. Limpossibilità di mantenere una corrispondeza univoca tra nucleotide ed aminoacido impone lutilizzo di una codifica AATGTATTC TTACATAAG AAUGUAUUC

14 Il codice genetico La necessità di codificare linformazione Se ci fosse una corrispondenza 1 a 1 tra nucleotide ed aminoacido si potrebbero utilizzare soltanto 4 aminoacidi per costruire una proteina. Se la corrispondenza fosse 2 ad 1 si potrebbero specificare 16 (4*4) aminoacidi. Sfortunatamente gli aminoacidi sono 20: sono quindi necessari 3 nucleotidi per identificare tutti gli aminoacidi esistenti. Le possibili combinazioni di 3 nucleotidi sono 64 (4*4*4). Poichè gli aminoacidi sono solo 20 esiste una surplus informativo di 44 triplette. La tabella n*m che mette in relazione le 64 possibili triplette di nucleotidi e i 20 aminoacidi è chiamata codice genetico. Il codice genetico è universale: una tripletta codifica lo stesso aminoacido in (quasi) tutti gli organismi viventi. Le triplette di nucleotidi sullmRNA vengono chiamate CODONI

15 Il codice genetico S E C O N D B A S E A GGU GGC GGA GGG Gly* AGU AGC AGA AGG Arg G CGU CGC CGA CGG Arg G UGU UGC UGA UGG C GAU GAC GAA GAG AAU AAC AAA AAG Glu CAU CAC CAA CAG A UAU UAC UAA UAG Stop Tyr GUU GUC GUA GUG Val AUU AUC AUA AUG start Ile CUU CUC CUA CUG Leu U UUU UUC UUA UUG Leu Phe Met/ GCU GCC GCA GCG Ala ACU ACC ACA ACG Thr CCU CCC CCA CCG Pro C UCU UCC UCA UCG Ser UCAGUCAG U UCAGUCAG UCAGUCAG UCAGUCAG Gln His Trp Cys THIRDBASETHIRDBASE FIRSTBASEFIRSTBASE Asp Lys Asn Stop Ser Il fenomeno per il quale esistono diverse triplette che codificano per lo stesso aminoacido è definito come degenerazione del codice La maggior parte degli aminoacidi è codificata da 2 o più triplette. La metionina è codificata solo dal codone AUG che rappresenta anche il codone di inizio della sintesi proteica. I codoni UGA UAA e UAG sono chiamati codoni di STOP. Ad essi con corrisponde nessun aminoacido ma rappresentano i segnali di terminazione per la sintesi proteica.

16 Il codice genetico Le conseguenze della degenerazione del codice E sempre possibile passare dallinformazione contenuta nei nucleotidi alla corrispondente sequenza proteica: ad ogni tripletta può essere associato uno ed un solo aminoacido. Non è mai possibile ottenere, in modo univoco, una sequenza nucleotidica a partire dalla sequenza proteica da essa generata MEFGLKEFLLNPSTPEGKLTPQRQTNPVWYACAWA Sequenza proteica AUG GAA GAGUUU UUC GGA GGC GGG GGU La retrotraduzione non è risolvibile in maniera esatta e non può essere dedotta dai sistemi biologici.

17 Il codice genetico Il vacillamento della terza base I CODONI CHE RAPPRESENTANO LO STESSO A.A., O A.A. CORRELATI, HANNO SEQUENZE SIMILI. SPESSO LA BASE CHE OCCUPA LA TERZA POSIZIONE DEL CODONE NON E SIGNIFICATIVA, COME DIMOSTRA IL FATTO CHE NEI GRUPPI DI 4 CODONI CHE RAPPRESENTANO LO STESSO A.A., SOLO LA TERZA BASE E DIFFERENTE.

18 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cennu sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

19 La traduzione La sintesi proteica viene chiamata anche traduzione poiché durante questo processo linformazione contenuta nellRNA messaggero viene tradotta utilizzando il codice genetico in una sequenza di aminoacidi. Durante la traduzione lmRNA interagisce con i macchinari molecolari deputati alla sintesi delle proteine: i RIBOSOMI. I ribosomi sono complessi formati da proteine ed RNA ribosomiale. LRNA ribosomiale ha funzione strutturale ma anche catalitica. Nel ribosoma delle particolari molecole di RNA chiamate RNA transfer (tRNA) traducono linformazione dellRNA messaggero in sequenza aminoacidica. Sono degli accoppiatori molecolari: da una parte hanno le funzioni molecolari per interagire con lRNA mentre dallaltra parte trasportano aminoacidi specifici.

20 La traduzione I Ribosomi IL RIBOSOMA E UNO DEI TANTI MACCHINARI CELLULARI. E costituito da RNA (rRNA) E PROTEINE (DETTE, PER LAPPUNTO, RIBOSOMALI). I RIBOSOMI CONSTANO DI DUE SUBUNITA: SUBUNITA MAGGIORE (IMPLICATA NELLA FORMAZIONE DEI LEGAMI PEPTIDICI); SUBUNITA MINORE (DOVE I tRNA SI ADATTANO AI CODONI DELLmRNA). CIASCUNA SUBUNITA E UN AGGREGATO DI rRNA E PROTEINE RIBOSOMALI.

21 La traduzione I Ribosomi QUANDO NON STANNO SINTETIZZANDO ATTIVAMENTE PROTEINE, LE DUE SUBUNITA DEI RIBOSOMI SONO SEPARATE. ESSE SI UNISCONO INSIEME SU UNA MOLECOLA DI mRNA IN GENERE VICINO ALLA SUA ESTREMITA 5 PER INIZIARE LA SINTESI PROTEICA.

22 La traduzione I tRNA Sono molecole adattatrici che legano e trasportano aminoacidi specifici. Due porzioni particolarmente importanti sono: ANTICODONE : sequenza di 3 nucleotidi complementari al codone corrispondente allaminoacido legato al tRNA. Sito di attacco dellaa. : sequenza 5- CCA-3,uguale in tutti tRNA. MET

23 La traduzione I tRNA Lanticodone si appaia in maniera specifica al codone sullmRNA in modo da permettere al tRNA di trasportare laminoacido corrispindente quando questo viene richiesto dalla informazione contenuta sul messaggero AUG MET UUAGCUUCGCGAUAUC

24 La traduzione Quanti sono i tRNA? UNA LOGICA DEDUZIONE PER QUANTO DETTO FINORA E CHE DOVREBBERO ESSERCI 61 tRNA DIVERSI, UNO PER CIASCUN CODONE; CIO IMPLICHEREBBE DUE COSE: 1.GRANDE CONSUMO ENERGETICO DA PARTE DELLA CELLULA; 2.tRNA AVENTI ANTICODONI DIFFERENTI DEVONO PORTARE LO STESSO aa. IN REALTA QUESTA CONDIZIONE E VERA SOLO PER ALCUNI tRNA, PER LA MAGGIORPARTE (NELLUOMO ESISTONO INFATTI SOLO 48 ANTICODONI DIFFERENTI A FRONTE DEI TEORICI 61 POSSIBILI), PERO, SUSSISTE IL FENOMENO DEL VACILLAMENTO DELLA TERZA BASE, PER CUI SI POSSONO FORMARE LEGAMI ANCHE NON ORTODOSSI FRA IL NUCLEOTIDE IN POSIZIONE 5 DEL tRNA E IL NUCLEOTIDE IN 3 DELLmRNA.

25 La traduzione Le fasi della traduzione 1)Inizio: la subunità minore del ribosoma si lega al messaggero. Il primo tRNA (quello della fMET) con anticodone complementare alla tripletta AUG, che rappresenta il segnale di inizio, si lega in corrispondeza del codone. Questo scatena il legame della subunità maggiore e linzio della traduzione. 2)Allungamento: il ribosoma si sposta in direzione 3 sul mRNA. I tRNA si legano uno dopo laltro ai codoni che via via vengono incontrati dal ribosoma mentre legge il filamento ribonucleotidico. Il ribosoma catalizza di volta in volta il legame tra laminoacido già presente allinterno del sito attivo ed il nuovo aminoacido appena entrato nel ribosoma allungando la catena proteica nascente di un aminoacido alla volta. 3)Terminazione: Quando il ribosoma incontra un segnale di stop nessun tRNA si lega al sito attivo del ribosoma. Si lagano invece specifici fattori di terminazione proteici che interrompono la traduzione e facilitano la destabilizzazione del complesso.

26 La traduzione Linizio della traduzione A E Large subunit P Small subunit fMet UAC GAG...CU-AUG--UUC--CUU--AGU--GGU--AGA--GCU--GUA--UGA-AT GCA...TAAAAAA 5 mRNA 3 La traduzione inizia col riconoscimento dellmRNA da parte della subunità minore. Il legame del tRNA della fMET (con anticodone complementare ad AUG) permette il legame della subunità maggiore.

27 La traduzione La fase di allungamento Un nuovo aminoacil tRNA (complesso tra tRNA ed il suo aminoacido corrispondente) entra nel sito A del ribosoma. Il suo anticodone è complementare al codone che si trova in corrispondenza del sito A. Il primo aminoacido (la metionina) presente nel sito P si troverà quindi vicino ad un nuovo aminoacido appena trasportato dal suo tRNA. La subunità maggiore del ribosoma catalizza il legame di questo nuovo aminoacodo con la metionina. Il legame della metionina con il suo tRNA viene rotto.

28 La traduzione La fase di allungamento A questo punto abbiamo un tRNA scarico nel sito P, un tRNA legato alla catena nascente (di due aminoacidi, al momento) nel sito A. Il ribosoma si sposta a sinistra sullmRNA: il tRNA vuoto viene liberato nel citoplasma, il tRNA legato a 2 aminoacidi viene spostato nel sito P ed il sito A è di nuovo disponobile per lattacco di un nuovo aminoacil-tRNA. Il processo viene iterato allungando ogni volta la catena nascente di un aminoacido, seguendo le istruzioni scritte sul messaggero.

29 La traduzione La fine della traduzione Quando il ribosoma, legato alla catena proteica nascente, raggiunge un codone di stop, invece di un aminoacil-tRNA, nel sito A si lega un fattore di terminazione. La proteina nascente lascia il suo tRNA, il ribosoma si destabilizza e la sintesi della proteina finisce.

30 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

31 Il folding delle proteine Le strutture delle proteine Abbiamo visto come le proteine vengono sintetizzate come lunghe catene lineari. La mera sequenza di aminoacidi della proteina viene definita struttura primaria. Ma gli aminoacidi di una proteina possono andare incontro ad interazioni che ne influenzano il ripiegamento nello spazio. La forma di una proteina ne influenzerà la funzione

32 Il folding delle proteine I 4 livelli strutturali delle proteine Struttura primaria: sequenza di aminoacidi Struttura secondaria: formazione di ripiegamenti regolari locali (alfa elica o foglietto beta) Struttura terziaria: formazione di una conformazione tridimensionale definitiva per interazione di più strutture globali Struttura quaternaria: interazione tra diversi polipeptidi (subunità) per la formazione di un complesso proteico completo e funzionale.

33 Il folding delle proteine SPESSO IN UN PEPTIDE SI TROVANO DUE SCHEMI REGOLARI DI RIPIEGAMENTO: L α-ELICA E IL FOGLIETTO β. ENTRAMBI DERIVANO DALLA FORMAZIONE DI LEGAMI H FRA I GRUPPI N-H E C=O DELLOSSATURA POLIPEPTIDICA, SENZA COINVOLGERE LE CATENE LATERALI DEGLI aa.

34 Il folding delle proteine α-ELICA SI FORMA QUANDO UNA SIGOLA CATENA POLIPEPTIDICA SI AVVOLGE SU SE STESSA PER FORMARE UN CILINDRO RIGIDO: IN PARTICOLARE SI INSTAURA UN LEGAME H FRA UN LEGAME PEPTIDICO E IL QUARTO SUCCESSIVO; SI GENERA COSI UNELICA REGOLARE DI PASSO UGUALE A 3,6 aa (CIOE 5,4Å). TIPICAMENTE, BREVI REGIONI AD α-ELICA SONO ABBONDANTI IN PROTEINE POSTE NELLE MEMBRANE CELLULARI (ES.: PROTEINE DI TRASPORTO E RECETTORI); IN ALTRE PROTEINE α-ELICHE SI AVVOLGONO LUNA INTORNO ALLALTRA PER FORMARE STRUTTURE STABILI NOTE COME COILED- COIL. (ES.: α-CHERATINA O MIOSINA). α-ELICA COILED-COIL

35 Il folding delle proteine FOGLIETTO β (O β-SHEET) SI FORMANO PER LEGAMI H TRA GRUPPI PEPTIDICI ADIACENTI APPARTENENTI A CATENE POLIPETIDICHE DIFFERENTI CHE POSSONO DECORRERE PARALLELE OD ANTI-PARALLELE (PARALLELE SE HANNO LO STESSO ORIENTAMENTO N-TERMINALE / C-TERMINALE; ANTIPARALLELE SE UNA DECORN-TERMINALE / C-TERMINALE IN DIREZIONE NORD-SUD O EST-OVEST E LALTRA N-TERMINALE / C-TERMINALE IN DIREZIONE SUD-NORD O OVEST-EST). I FOGLIETTI BETA COSTITUISCONO IL CORE DI MOLTE STRUTTURE PROTEICHE FOGLIETTO β (O β-SHEET)

36 Il folding delle proteine STRUTTURE SUPER SECONDARIE, MOTIVI STRUTTURALI a elica - loop - a elica: è presente in molte proteine che legano il Ca (calmodulina e troponina C). b-turn: due filamenti b antiparalleli uniti da un breve loop di 2-5 residui. chiave greca: per formare questo motivo occorrono (minimo) quattro filamenti b, due brevi loop e un loop più lungo. b-a-b: è costituito da due filamenti b paralleli, intercalati da un'a-elica.

37 Il folding delle proteine La struttura terziaria

38 Il folding delle proteine La struttura quaternaria A VOLTE LE PROTEINE CONSTANO DI PIU SUBUNITA PEPTIDICHE (CIASCUNA GIA RIPIEGATA NELLA SUA STRUTTURA 3D) CHE INTERAGISCONO TRA LORO TRAMITE LEGAMI NON COVALENTI (LEGAMI H ED INTERAZIONI IDROFOBICHE PRINCIPALMENTE) A FORMARE UNUNICA STRUTTURA FUNZIONALE: LA PRO= TEINA AVENTE STRUTTURA QUATERNARIA. Es.:PROTEINA EMOGLOBINA

39 Il folding delle proteine I livelli di organizzazione di una proteina

40 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

41 Genotipo e fenotipo Il genotipo di un individuo è dato dal suo corredo genetico, è ciò che è "scritto" nel DNA contenuto nel nucleo di tutte le sue cellule ed è quindi immutabile. Il fenotipo, invece, è l'insieme dei caratteri che l'individuo manifesta: dipende dal suo genotipo, dalle interazioni fra geni e anche da fattori esterni; dunque può variare. IL GENOTIPO È linformazione genetica IL FENOTIPO È il modo in cui questa viene espressa

42 Genotipo e fenotipo Il padre della genetica è Mendel. Nel tempo libero amava fare esperimenti incrociando diverse varietà della pianta dei piselli. Fu lui a definire per la prima volta i concetti di genotipo e fenotipo. Una pianta con seme giallo, incrociata con una pianta con seme giallo dava sempre progenie con seme giallo. Una pianta con seme verde, incrociata con una pianta con seme verde dava sempre progenie con seme verde. Una pianta con seme giallo, incrociata con una pianta con seme verde dava sempre progenie con seme giallo. Il giallo è DOMINANTE

43 Genotipo e fenotipo Il bello viene adesso: Se incrociamo le piante a seme giallo originate dai genitori misti (seme giallo e seme verde) non otteniamo più solo piante a seme giallo ma anche qualche piantina a seme verde!!!. Le piante a seme giallo che incrociate tra loro danno sempre seme giallo e le piante a seme giallo che incrociate tra loro danno ANCHE piante a seme verde sono FENOTIPICAMENTE IDENTICHE (hanno seme giallo) ma GENOTIPICAMENTE le seconde hanno linformazine per esprimere il carattere seme verde quindi sono GENOTIPICAMETE DIFFERENTI.

44 Genotipo e fenotipo I Sintesi: Il FENOTIPO dipende dal GENOTIPO ma FENOTIPI identici possono avere GENOTIPI diversi!

45 Outline Il flusso dellinformazione genica Le proteine – natura ed informazione Il codice genetico La traduzione (sintesi proteica) Cenni sul folding delle proteine Genotipo e fenotipo Mutazioni e polimorfismi

46 Come abbiamo detto le mutazioni sono variazioni della sequenza di basi nel DNA. Le mutazioni possono avere diversi effetti a seconda: Della loro natura (tipo di mutazione) Della loro posizione (dove avvengono)

47 Mutazioni e polimorfismi Le mutazioni di più piccola entità sono le mutazioni puntiformi: Sono caratterizzate dalla sostituzione di un nucleotide con un altro ACTGTTGCTACTGGCGCGTT ACTGTTGCTAATGGCGCGTT Mutazioni puntiformi Sono definite: transizioni qualora vi è un scambio di una purina con altra purina (A G) o di una pirimidina con un'altra pirimidina (C T) transversioni quando lo scambio è di una purina con un a pirimidina o viceversa (C/T A/G).

48 Mutazioni e polimorfismi Le mutazioni più gravi sono le mutazioni indel: Sono caratterizzate dalla inserzione o delezione di uno o più nucleotidi ACTGTTGCTACTGGCGCGTT ACTGTTGCTACATGGCGCGTT Inserzioni e delezioni (indel) Possono causare uno spostamento della fase di lettura (frameshift): ACTGTTGCTACTGGCGCGTTACTGTTGCTACATGGCGCGTT Tutta la zona a valle della mutazione verrà influenzata. La probabilità di formare codoni di stop prematuri è elevata (proteina troncata)

49 Mutazioni e polimorfismi Le mutazioni possono cadere: In una regione genica (compresa tra linizio e la fine di un gene) In una regione intergenica La posizione della mutazione La mutazione in una regione intergenica, di solito, non ha nessun effetto sul fenotipo, e sono quindi maggiormente tollerate dalla selezione naturale. Tuttavia in alcuni rari casi le mutazioni possono interferire con il riconoscimento del DNA da alcune proteine regolatrici ed interferire con alcuni processi cellulari essenziali.

50 Mutazioni e polimorfismi Se la mutazione avviene in questa regione si possono avere diverse eventualità: La mutazione è avvenuta nella regione codificante: linformazione trascritta nellmRNA maturo cambia. La mutazione è avvenuta in un introne: linformazione trascritta nellmRNA maturo non cambia (almeno, non sempre) La mutazione è avvenuta in una regione regolatrice (promotore, enhancer, silencer): la regolazione (produzione di mRNA) può essere influenzata. Mutazioni alinterno della regione genica

51 Mutazioni e polimorfismi LmRNA viene alterato. Se si tratta di una mutazione puntiforme un solo codone verrà cambiato in un altro. Esistono tre tipi di mutazioni puntiformi: mutazioni sinonime: quando la mutazione determina un codone diverso ma che codifica per lo stesso amminoacido (questo è possibile grazie alla ridondanza del nostro codice genetico ). Non si avrà alcun cambiamento nel prodotto genico. mutazioni di senso errato: quando un codone viene sostituito con uno che codifica per un altro amminoacido. Se quest'ultimo avrà le stesse caratteristiche chimiche (dimensione, carica...) allora la sostituzione sarà conservativa altrimenti non conservativa. E' chiaro che il secondo caso rende più probabile una variazione nella funzionalità del prodotto. mutazioni non senso: quando la mutazione determina la formazione di un codone di stop all'interno della sequenza. Questo provoca, se il prodotto è una proteina, un'interruzione precoce della sua sintesi nella traduzione. In generale maggiore sarà il frammento non tradotto maggiore sarà il rischio di una mutazione svantaggiosa. Se si tratta di una mutazione indel tutti i codoni a valle delle mutazione verranno cambiati. Mutazioni nella regione codificante

52 Mutazioni e polimorfismi Gli introni vengono di solito alterati, quindi la mutazione potrebbe non avere alcun effetto però: Lo splicing alternativo potrebbe considerare come esone lintrone in cui è avvenuta la mutazione con conseguente possibilità di variazione nel prodotto proteico (vedi caso precedente) Se la mutazione avviene in corrispondenza dei siti accettore o donatore di splicing questo processo potrebbe non avvenire correttamente. Mutazioni in un introne

53 Mutazioni e polimorfismi La regolazione del gene potrebbe essere alterata: -Mancata produzione di mRNA -Ridotta produzione di mRNA -Aumentata produzione di mRNA Mutazioni in regione regolatrice


Scaricare ppt "Bioinformatica Corso di Laurea specialistica in Informatica Traduzione e Proteine 23/04/2011."

Presentazioni simili


Annunci Google