La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Lalanina è un -amminoacido acido 2(S)-ammino propanoico.

Presentazioni simili


Presentazione sul tema: "Lalanina è un -amminoacido acido 2(S)-ammino propanoico."— Transcript della presentazione:

1

2 Lalanina è un -amminoacido acido 2(S)-ammino propanoico

3 La -alanina è un -amminoacido

4 acido 4-ammino butanoico Il GABA è un -amminoacido

5 Gli amminoacidi che si ottengono dall'idrolisi delle proteine sono tutti -amminoacidi CHH 2 N COOH R

6 Gli -amminoacidi naturali appartengono serie sterica L tutti alla serie sterica L. (ad eccezione della glicina, che non ha atomi di carbonio asimmetrici)

7 Allo stato cristallino gli amminoacidi sono nella forma zwitterionica H C OO CHN H H R - +

8 Gli amminoacidi naturali differiscono per la struttura della catena laterale Gruppo funzionale CHH 2 N C OOH R

9 R apolare COO - C H R H3NH3N + Gly Ala Val Leu Ile Pro GAVLIP

10 H CHH3NH3N + GlicinaGlyG

11 CH 3 COO - CHH3NH3N + AlaninaAlaA

12 CH 2 COO - CHH3NH3N + CH CH 3 H3CH3C LeucinaLeuL

13 C CH 2 H COO - CHH3NH3N + IsoleucinaIleI

14 C HH3NH3N + CH CH 3 H3CH3C ValinaValV

15 HH N CH COO - CH 2 H2CH2C H2CH2C + ProlinaProP

16 COO - C H R H3NH3N + Ser Thr Cys Met Asn Gln R polare non carica STCMNQ

17 CH 2 OH COO - CHH3NH3N + SerinaSerS

18 C CH 3 H OH COO - CHH3NH3N + TreoninaThrT

19 SH CH 2 COO - CHH3NH3N + CisteinaCysC

20 CH 2 S CH 3 CH 2 COO - CHH3NH3N + MetioninaMetM

21 CHH3NH3N + C CH 2 OH2NH2N AsparaginaAsnN

22 COO - CHH3NH3N + C CH 2 OH2NH2N GlutamminaGlnQ

23 R aromatica COO - CH R H3NH3N + Phe Tyr Trp FYW

24 CHH3NH3N + CH 2 FenilalaninaPheF

25 OH COO - CHH3NH3N + CH 2 TirosinaTyrY

26 COO - CHH3NH3N + N H CH 2 TriptofanoTrpW

27 COO - CH R H3NH3N + Asp Glu R con carica negativa DE

28 CH 2 COO - CHH3NH3N + Ac. aspartico AspD

29 CH 2 COO - CHH3NH3N + Ac. glutammico GluE

30 COO - CH R H3NH3N + Lys His Arg R carica positivamente KHR

31 CH 2 NH 3 + COO - CHH3NH3N + LisinaLysK

32 CHH3NH3N + H N N CH 2 H + IstidinaHisH

33 NH C NH 2 + COO - CHH3NH3N + ArgininaArgR

34 Alcuni amminoacidi sono essenziali o indispensabili

35 [G] glicina [G] (Gly) H COO - CHH3NH3N + [A] alanina [A] (Ala) CH 3 COO - CHH3NH3N + [I] isoleucina [I] (Ile) C CH 3 CH 2 H COO - CHH3NH3N + [L] leucina [L] (Leu) CH 2 COO - CHH3NH3N + CH CH 3 H3CH3C [V] valina [V] (Val) COO - CHH3NH3N + CH CH 3 H3CH3C [P] prolina [P] (Pro) HH N CH COO - CH 2 H2CH2C H2CH2C + indispensabili

36 [S] serina [S] (Ser) CH 2 OH COO - CHH3NH3N + C CH 3 H OH [T ] Treonina [T ] (Thr) COO - CHH3NH3N + [C] cisteina [C] (Cys) SH CH 2 COO - CHH3NH3N + [M] Metionina [M] (Met) CH 2 S CH 3 CH 2 COO - CHH3NH3N + CH 2 [Q] (Q)lutammina [Q] (Gln) COO - CHH3NH3N + C CH 2 OH2NH2N [N] asparagiNa [N] (Asn) COO - CHH3NH3N + C CH 2 OH2NH2N indispensabili Attenzione!!!: Attenzione!!!: la corruzione del nome di alcuni AA è solo un trucco mnemonico utile a ricordarne i simboli

37 [W] Tripto(W)fano [W] (Trp) [Y] tYrosina [Y] (Tyr) [F] Fenilalanina [F] (Phe) COO - CHH3NH3N + N H CH 2 COO - CHH3NH3N + CH 2 OH COO - CHH3NH3N + CH 2 indispensabili Attenzione!!!: Attenzione!!!: la corruzione del nome di alcuni AA è solo un trucco mnemonico utile a ricordarne i simboli

38 [D] acido aspar(D)ico [D] (Asp) CH 2 COO - CHH3NH3N + [E] acido glu(E)tammico [E] (Glu) CH 2 COO - CHH3NH3N + Attenzione!!!: Attenzione!!!: la corruzione del nome di alcuni AA è solo un trucco mnemonico utile a ricordarne i simboli

39 [K] (K)lisina [K] (Lys) [H] (H)istidina [H] (His) CH 2 NH 3 + COO - CHH3NH3N + [R] aRginina [R] (Arg) CH 2 NH C NH 2 + COO - CHH3NH3N + CHH3NH3N + H N N CH 2 H + Tutti indispensabili Attenzione!!!: Attenzione!!!: la corruzione del nome di alcuni AA è solo un trucco mnemonico utile a ricordarne i simboli

40 Caratteristiche chimiche degli amminoacidi

41 + PLP C OH H + N CH 2 OPO 3 H 2 HO H3CH3C COO H C HR NH 2 -amminoacido aldimmina HC COO H C HR N + N CH 2 OPO 3 H 2 HO H3CH3C H - H 2 O + H 2 O

42 H HC + N CH 2 OPO 3 H 2 HO H3CH3C COO H C H R N chetimmina H HC + N CH 2 OPO 3 H 2 HO H3CH3C COO H C H R N aldimmina

43 + H 2 O - H 2 O -chetoacido chetimmina H HC + N CH 2 OPO 3 H 2 HO H3CH3C COO H C H R N C R O + H CH 2 + N CH 2 OPO 3 H 2 HO H3CH3C NH 2 piridossammina-fosfato

44 -amminoacido 1 + -chetoacido 2 -chetoacido 1 + -amminoacido 2 Transamminasi PLP-dipendente

45 ninidrina C C O O OH C C O O ninidrina COOH C H R H2NH2N amminoacid o pigmento violaceo N O O OH C C O C C CO 2 R C O H 3 H 2 O

46 riduzione (+2H)ossidazione (-2H) cistina SH CH 2 COO - CHH3NH3N + SH CH 2 COO - CHH3NH3N + S CHH3NH3N + SH2CH2C CHH3NH3N + CH 2 cisteina

47 Allo stato cristallino gli amminoacidi sono nella forma zwitterionica (anfionica) H C OO CHN H H R - +

48 gli amminoacidi sono anfoliti forma anionica forma anfionica forma cationica

49 Gli amminoacidi* possono essere considerati acidi diprotici *monocarbossilici e monoamminici Ciascuno dei due equilibri comporta la possibilità che lamminoacido funzioni da tampone Ciascuno dei due equilibri comporta la possibilità che lamminoacido funzioni da tampone

50 Il pKa 1 degli amminoacidi è influenzato dal gruppo amminico pKa 1 = 2.34 glicina (ac. amminoacetico) pKa = 4.75 acido acetico

51 OH - (equivalenti) pK a1 = 2.34 pK 2 = 9.60 PuntoisoelettricoPuntoisoelettrico COOH C HH3NH3N H pH H2OH2O Ka 1 COO - C HH3NH3N H + OH - Ka 2 COO - C HH2NH2N H H2OH2OH2OH2O OH - + NaOH

52 Al punto isoelettrico [AH 2 ] = [A - ] + AH 2 + A-A- AH =

53 Ka 1 = [AH] [H + ] [AH 2 + ]. Ka 2 = [A - ] [H + ] [AH]. AH 2 + AH + H + Ka 1 A-A- AH + H + Ka 2 Per calcolare a quale valore di pH si abbia il punto isoelettrico dellamminoacido si può ricorrere ad un artificio matematico

54 K1K1 = [AH] [H + ] [AH 2 + ]. K2K2 = [A - ][H + ] [AH]. K1·K2K1·K2 = [H + ] [AH 2 + ]. · [A - ][H + ] [AH]. Dal prodotto delle due equazioni si ottiene la seguente : Elidendo i termini che compaiono sia al numeratore che al denominatore...

55 K1·K2K1·K2 = [AH] [H + ] [AH 2 + ]. · [A - ][H + ] [AH]. = [AH 2 + ] [A - ] [H 3 O + ] 2 = K 1 · K 2 deriva che : pK 1 + pK 2 pI = 2 E considerando che al punto isoelettrico E quindi:

56 R non polare R aromatico R polare non carico R negativo R positivo glicina alanina valina leucina isoleucina prolina fenilalanina tirosina triptofano serina treonina cisteina metionina asparagina glutammina aspartato glutammato lisina arginina istidina pK 1 pK 2 pK R

57 Gli amminoacidi si legano contraendo legami peptidici

58

59 Mesomeria del gruppo funzionale peptidico Planarità del gruppo funzionale peptidico

60 seril-glicil-aspartil-alanil-leucina S GDA L amminoacido N-terminale amminoacido C-terminale SGDAL

61 2,4-dinitro-fluorobenzene identificazione dell'amminoacido N-terminale + HF

62 idrolisi dinitrofenil-peptide dinitrofenil-AA + gli altri AA

63 SGDAL GDAL / GDLA / GADL / GALD / GLDA / GLAD DALG / DAGL / DGAL / DGLA / DLAG / DLGA ADLG / ADGL / AGLD / AGDL / ALGD / ALDG LDAG / LDGA / LGDA / LGAD / LAGD / LADG 24 combinazioni possibili degli altri 4 AA (n!) S GDA L

64 Determinazione della sequenza mediante degradazione di Edman idrolisi oligopeptide di n-1 AA (pronto per il ciclo successivo) fenilisotiocianato

65 Nei polipeptidi, oltre al legame peptidico, esistono anche altre interazioni fra amminoacidi. Queste interazioni danno origine a strutture superiori -SCALIQAFTYKESENQPCTGWDFSIMDFIFESGDAL

66

67 Ogni polipeptide allo stato nativo ha uno specifico folding, che è determinato dalla sua struttura primaria

68 Le quattro interazioni deboli implicate nel folding di un polipeptide in ambiente acquoso Legame H Interazione idrofobica Forze di van der Waals fra catene laterali fra gruppi amidici 3-7 kcal/mole 1-2 kcal/mole < 1 kcal/mole Legame ionico attrazionerepulsione 10 kcal/mole10 kcal/mole

69 La ribonucleasi batterica barnasi, un piccolo polipeptide di 110 aminoacidi e 12.4 kDa di massa molecolare, è un buon modello per descrivere il folding di un polipeptide Forze implicate nel folding della barnasi Phe7Val10 Ala11Leu14 Leu20Tyr24 Ala74Ile76 Ile88Tyr90 Trp94Ile96 Ile109 Effetto idrofobico

70 Core idrofobico della barnasi Forze implicate nel folding della barnasi Core idrofobico della barnasi Phe56Leu63 Trp71Leu89 Tyr97Tyr103 Phe106

71 Legami idrogeno Forze implicate nel folding della barnasi Legami idrogeno Barnase – helix I Phe7-Asp-Gly-Val-Ala-Asp-Tyr-Leu-Gln-Thr-Tyr-His18 Amphipathic

72 Interazioni elettrostatiche Forze implicate nel folding della barnasi Interazioni elettrostatiche Arg69 Asp93 Rompendo questo legame ionico la proteina diventa unfolded

73 Ponti disolfuro Forze implicate nel folding della barnasi Ponti disolfuro Ser-Cys85 His-Cys102 mutante

74 Planarità e isomeria cis/trans Angoli diedri di torsione intorno ai legami e Angoli diedri di torsione intorno ai legami e Conseguenze della mesomeria del gruppo funzionale peptidico

75 Queste torsioni sono limitate dallingombro sterico (e da interazioni elettrostatiche). Queste torsioni sono limitate dallingombro sterico (e da interazioni elettrostatiche). La piccola catena laterale della alanina impedisce le modificazioni conformazionali molto meno di quella, più ingombrante, del triptofano. La glicina gode della massima libertà conformazionale mentre la prolina, per la struttura ciclica in cui è compreso lazoto del gruppo funzionale, ha una libertà di modificazioni conformazionali fortemente limitata. R R

76 Il paradosso di Levinthal Per un polipeptide di 101 amminoacidi : = 2x10 90 conformazioni possibili. Con una frequenza di modificazione conformazionale = s -1 (diecimila milardi di volte al secondo) al polipeptide occorrerebbero poco meno di anni per assumere tutte le conformazioni possibili

77 Cooperatività The folding funnel G stato folded

78 Ogni polipeptide allo stato nativo ha uno specifico folding, che è determinato dalla sua struttura primaria

79

80 Legame H della struttura secondaria Legame H della struttura secondaria C O N R C H H N C O C H N H C C

81 - elica - elica Mioglobina & GAPDH Mioglobina & GAPDH

82 - sheet antiparallelo - sheet antiparallelo - sheet parallelo - sheet parallelo Struttura secondaria a foglietto pieghettato

83 STRUTTURACARATTERISTICHEESEMPI -elica con cross-linking di cistina 0,54 nm/giro dellelica 3,6 residui AA/ giro dellelica Catene laterali rivolte allesterno -cheratina (peli, unghie, piume) durezza e rigidità durezza e rigidità (variabili) -sheet distanza fra i residui: 0,65-0,70 nm o 0,34 nm Catene laterali alternativamente sopra e sotto il piano Fibroina della seta Filamenti flessibili Tripla elica del collageno Coiled-coils determinati da legami non-covalenti (talora anche da ponti disolfuro) Collagene dei tendini, proteine della matrice ossea Alta resistenza alla tensione Effetti della struttura secondaria sulle caratteristiche dei polipeptidi

84 -cheratina -cheratina

85

86

87 Coiled-coils(collageno)

88 Si definiscono legami della struttura terziaria tutti i legami che si stabiliscono fra catene laterali di amminoacidi costituenti la stessa catena polipeptidica

89

90 Gliceraldeide-3-fosfato-deidrogenasi rasmol

91

92 Struttura quaternaria dellemoglobina

93

94 R non polare R aromatico R polare non carico R negativo R positivo prolinaglicinaalaninaleucinavalinaisoleucinatirosinatriptofanofenilalaninaasparaginaglutamminaserinatreoninametioninacisteinaaspartatoglutammatoargininalisinaistidina indice idropatico

95

96 2D-PAGE

97 La soluzione proteica viene risolta nelle sue componenti mediante focalizzazione isoelettrica su un gradiente di pH immobilizzato pH 3pH proteine acide proteine basiche Ogni proteina migra nel campo elettrico fino a raggiungere la zona il cui pH (immobilizzato) corrisponde al suo punto isoelettrico gradiente di pH immobilizzato

98 +- Gel di poliacrilammide Gel di agarosio

99 +-

100 SDS – 2D PAGE Mr (kD) pI Mr pI Ad ogni proteina (spot) corrisponde uno specifico valore di Mr e di pI

101 Una procedura semplice per lanalisi proteomica colturacellulare o tessuto estratto proteico elettroforesi bidimensionale spot picking digestionetriptica ricerca in banca-dati Spettrometria di massa identificazione

102

103 mioglobina eme


Scaricare ppt "Lalanina è un -amminoacido acido 2(S)-ammino propanoico."

Presentazioni simili


Annunci Google