La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Alimentazione e Nutrizione Il bisogno di nutrimento è dovuto alla necessità da un lato di avere a disposizione una sufficiente quantità di energia e dallaltro.

Presentazioni simili


Presentazione sul tema: "Alimentazione e Nutrizione Il bisogno di nutrimento è dovuto alla necessità da un lato di avere a disposizione una sufficiente quantità di energia e dallaltro."— Transcript della presentazione:

1 Alimentazione e Nutrizione Il bisogno di nutrimento è dovuto alla necessità da un lato di avere a disposizione una sufficiente quantità di energia e dallaltro di integrare con continuità ed in quantità ben definita le sostanze che compongono il corpo umano e che, a seguito della sua incessante attività, sono soggette ad usura e perdite. ingestionedigestioneassorbimentoAlimento utilizzazione dei principi nutritivi e dellenergia chimica prodotti Eliminazione prodotti di rifiuto Alimentazione nutrizione Cibi molecole

2 principi nutritivi I principi nutritivi sono sostanze chimiche che si trovano più o meno in tutti gli alimenti, ma in quantità diverse dalluno allaltro e agiscono nellorganismo essenzialmente in vari modi: 1.funzione energetica (grassi e carboidrati; in misura minore le proteine); 2.funzione plastica (proteine); 3.funzione protettiva; 4.funzione regolatrice (vitamine e sali minerali); 5.funzione di riserva (grassi) Un principio nutritivo è una sostanza che assolve ad una o più delle suddette funzioni. Le funzioni dei principi nutritivi

3 Le quantità dei principi nutritivi LARN: Livelli di Assunzione Raccomandata di Nutrienti (1996- ultima revisione 2003) RDA: Recommended Dietetic Allowances secondo LARNsecondo Linee Guida INRAN Proteine10-12%Proteine15% Carboidrati55-60%Carboidrati60% Lipidi< 30%Lipidi25% (15%) (60%) (25%)

4 Alimentazione e Nutrizione

5

6

7 Enzimi digestivi presenti sulla superficie delle cellule della mucosa dellintestino tenue. Enzima (nome comune)Substrato MaltasiMaltosio Saccarasi/isomaltasiSaccarosio/alfa ( )-destrina limite GlucoamilasiAmilosio TrealasiTrealosio -GlucosidasiGlucosilceramide LattasiLattosio EndopeptidasiProteine (scissione a livello di amminoacidi idrofobici interni) Amminopeptidasi AOligopeptide con amminoacido N-terminale acido Amminopeptidasi NOligopeptide con amminoacido N-terminale neutro Dipeptidilamminopeptidasi IVOligopeptide con X-Pro o X-Ala in corrispondenza dellNH2 Terminale Leucina amminopeptidasiPeptide con un amminoacido neutro in corrispondenza dell'N terminale -glutammiltrasferasiGlutatione + amminoacido neutro Enteropeptidasi (enterochinasi)Tripsinogeno Fosfatasi alcalinaEsteri fosforici organici

8 Alimentazione e Nutrizione

9

10 Agenti secretagoghi: le ammine biogene

11

12 EMBO J.EMBO J Jul 3;14(13): Tyrosine O-sulfation promotes proteolytic processing of progastrin. Bundgaard JRBundgaard JR, Vuust J, Rehfeld JF.Vuust JRehfeld JF Source Department of Clinical Biochemistry, State University Hospital, Copenhagen, Denmark. Abstract Tyrosine O-sulfation is a common post-translational modification of secretory and membrane proteins. The biological function of sulfation is known in only a few proteins, where it appears to enhance protein-protein interactions. Based on known sequences around sulfated tyrosines, a consensus sequence for prediction of target tyrosines has been proposed. However, some proteins are tyrosine sulfated at sites that deviate from the proposed consensus. Among these is progastrin. It is possible that the deviation explains the incomplete sulfation characteristic for bioactive gastrin peptides. In order to test this hypothesis, we have performed site-directed mutagenesis of the gastrin gene followed by heterologous expression in an endocrine cell line. The results show that substitution of the alanyl residue immediately N-terminal to the sulfated tyrosine with an acidic amino acid promotes the sulfation of gastrin peptides. Hence, the study supports the proposed consensus sequence for tyrosine sulfation. Importantly, however, the results also reveal that complete sulfation increases the endoproteolytic maturation of progastrin. Thus, our study suggests an additional function for tyrosine sulfation of possible general significance.

13 Agenti secretagoghi : i peptidi

14 Bos taurus MQRLCAHVLILVLALAAFCEASWKPHSHLQDLPVAPRANRGQ EPLRMTR LGPASNPRR QLGLQDPPHMVA DLSNKQGPWVGEEEAAYGWMDF GRRMAEGGDQHP Human 1 MQRLCVYVLI FALALAAFSE ASWKPRSQQP DAPLGTGANR DLELPWLEQQ GPASHHRR QL 61 GPQGPPHLVA DPSKKQGPWL EEEEEAYGWM DF grrsaede n QLGPQGPPHLVA DPSKKQGPWL EEEEEAYGWM DF

15 Membrane luminali e controluminali Il trasporto di soluti può essere di tipo transcellulare o paracellulare

16 Peptidasi gastriche e pancreatiche

17 Trasportatori di Amminoacidi

18 Carboidrati a scopo alimentare

19 Saccaridasi

20 Trasportatori del glucosio

21 I cibi possono contenere sostanze direttamente assorbibili (ad es., lacqua), oppure dei principi alimentari che sono assorbiti dopo idrolisi a nutrienti (amido, proteine, polisaccaridi ecc). Altre molecole presenti nei cibi non sono definibili come nutrienti, ma sono estremamente importanti come cofattori per la catalisi biologica (vitamine e sali minerali). Altre sostanze possono essere importanti per ragioni tossicologiche (contaminanti ambientali) e/o fisiologiche (antiossidanti) e quindi avere effetti sulla salute delluomo. Alimenti o cibi contengono sono idrolizzati a Nutrienti (nutrienti semplici, sostanze direttamente assorbibili e altre molecole) Principi alimentari (nutrienti complessi) Le funzioni dei principi nutritivi

22 Nutrienti Tabella 4 - Valutazione nutrizionale della razione alimentare giornaliera formulata sulla base delle porzioni. Energia kcal ProteineCarboidratiLipidi 75 g (15% dell energia) 290 g (55% dell energia) 65 g (30% dell energia) Amido 220g Carboidrati solubili 70 g Saturi (7% en.) Mono-insaturi (18% en.) Poli- insaturi (4% en.) FibraColesterolo g 23mg 255 Minerali CalcioFosforoFerroSodioPotassio 876 mg1200 mg11 mg2270 mg3042 mg Vitamine Vit B 1 Vit B 2 Vit CVit PPVit A 1,02 mg 1,6 mg 163 mg29 mg935 µ g

23 Alimentazione equilibrata alimentazione equilibrata Unalimentazione equilibrata dovrebbe: 1.assicurare un apporto di energia adeguato al reale fabbisogno energetico è determinato da ben definiti fattori (età, sesso, taglia fisica, peso corporeo, attività fisica svolta) che condizionano il maggiore o minore dispendio di energia dellorganismo. 2.tenere nella dovuta considerazione anche la composizione in principi nutritivi dei cibi che compongono la nostra dieta comprendere tutte le categorie di alimenti, per fornire allorganismo i principi nutritivi necessari. Non esiste quindi "lalimento completo" che contenga tutti i principi nutritivi nelle quantità che ci sono necessarie. Nessun alimento è strettamente indispensabile, in quanto qualunque prodotto può essere sostituito da un altro di valore nutritivo simile.

24 Nutrienti essenziali Con il termine NUTRIENTE ESSENZIALE si indica: una sostanza richiesta nellalimentazione per la crescita, la salute e la sopravivenza; una sostanza la cui assenza dallalimentazione dà origine a segni caratteristici di malattia, imputabili alla deficienza; un nutriente in grado di prevenirne lincapacità di crescere e i segni caratteristici di deficienza, cosa che altre sostanze non sono i grado di fare. Lessenzialità è una caratteristica della specie, non del nutriente Dal punto di vista biochimico, lessenzialità di un nutriente implica lincapacità, assoluta o relativa, di sintetizzare il nutriente considerato a partire da altri.

25 Nutrienti essenziali per la specie umana Nutrienti essenziali I cibi, inoltre, contengono molecole che non possono essere considerate nutrienti essenziali, ma che sono utili alla salute (fibra alimentare, fluoro).

26 Essenzialità condizionata un nutriente solitamente non essenziale per quella specie, diventa essenziale in per quella specie, diventa essenziale in talune situazioni fisiologiche. talune situazioni fisiologiche. Immaturità di sviluppo – neonati pre-termine (sono essenziali cisteina e tirosina, i derivati di acido linoleico e linolenico, la taurina, la carnitina). Immaturità di sviluppo – neonati pre-termine (sono essenziali cisteina e tirosina, i derivati di acido linoleico e linolenico, la taurina, la carnitina). Stati patologici (cirrosi epatica cisteina e tirosina; Stati patologici (cirrosi epatica cisteina e tirosina; pazienti tumorali colina; ipercatabolismo glutammina) Difetti genetici (incapacità di sintesi di carnitina miopatie) Difetti genetici (incapacità di sintesi di carnitina miopatie) Modificazioni dei bisogni di nutrienti essenziali: Relazioni precursori-prodotto (nutrienti essenziali che originano da altri nutrienti); ad esempio, fenilalanina tirosina, metionina cisteina, tirptofano niacina, carotenoidi vitamina A) Relazioni precursori-prodotto (nutrienti essenziali che originano da altri nutrienti); ad esempio, fenilalanina tirosina, metionina cisteina, tirptofano niacina, carotenoidi vitamina A) Sproporzione con nutrienti correlati (fabbisogno vitamina E > acidi grassi polinsaturi) Sproporzione con nutrienti correlati (fabbisogno vitamina E > acidi grassi polinsaturi) Difetti genetici (vitamina coenzima) Difetti genetici (vitamina coenzima) Interazioni farmaci-nutrienti (ostacolo o antagonismo dellassorbimento di nutrienti, vitamine e minerali) Interazioni farmaci-nutrienti (ostacolo o antagonismo dellassorbimento di nutrienti, vitamine e minerali) Nutrienti essenziali

27 Densità nutrizionale Questi concetti sono molto importanti nella formulazione di una dieta: Non è solo rilevante la quantità di energia che essa è capace di fornire, ma anche la quantità di nutrienti essenziali che essa contiene DENSITÀ NUTRIZIONALE quota dei fabbisogni quotidiani di ogni nutriente soddisfatte con il consumo di un determinato prodotto alimentare o con il consumo di una certa razione. Il calcolo dei valori di densità nutritiva e la loro espressione grafica rappresenta una forma semplice, sintetica ed immediata per documentare il valore nutritivo di un prodotto o di una razione alimentare.

28 Densità nutrizionale La densità nutrizionale è uno dei criteri per mettere a confronto il valore nutrizionale e il valore calorico. La quantità di nutrienti necessaria si esprime in percentuale. Questa percentuale viene confrontata con la percentuale di calorie effettive provenienti da un determinato alimento. Per essere nutriente, un alimento deve avere una densità pari o superiore a 3. Il kiwi ha una densità nutrizionale pari a 16.

29 Densità nutrizionale Rapportando il valore di densità nutritiva per un singolo nutriente al dato relativo dell´energia si ottiene un´immediata informazione di quanto un alimento sia una fonte elettiva di nutrienti e contemporaneamente di quanto non appesantisca il bilancio calorico quotidiano. Se un prodotto, per ipotesi, copre il 20 % del fabbisogno in vitamina C e solo il 5 % di quello di energia, significa che esso è una fonte privilegiata di vitamina C: nutre (in vitamina C), ma apporta poche calorie. E buona norma cercare di associare correttamente gli alimenti onde soddisfare in misura equilibrata e proporzionale le esigenze energetiche e nutrizionali.

30 biodisponibilità Gli alimenti sono le fonti di nutrienti, ma il contenuto di nutrienti non è sufficiente a definire la qualità nutrizionale di un alimento, poiché questa dipende anche dalla biodisponibilità e da altre caratteristiche dei nutrienti. La biodisponibilità di un nutriente è la quantità presente in un alimento in concentrazione e forma chimica necessaria al suo assorbimento. Dipende anche: dalle caratteristiche del nutriente dalle caratteristiche del nutriente dalla presenza di antinutrienti dalla presenza di antinutrienti dai processi di digestione e assorbimento dello specifico nutriente. dai processi di digestione e assorbimento dello specifico nutriente. Pertanto, essa è strettamente correlata con la percentuale di nutriente (rispetto al contenuto totale) che viene effettivamente utilizzata dallorganismo. Biodisponibilità

31 In generale, il fabbisogno è la quantità di ciascun nutriente necessaria per mantenere un essere umano in buona salute Il fabbisogno quotidiano di un individuo dipende da: età, sesso, massa corporea, attività fisica TABELLE DI ASSUNZIONE RACCOMANDATA DI NUTRIENTI Indicano la quantità di ciascun nutriente essenziale necessaria per non incorrere in sintomi di carenza. Fabbisogno di nutrienti

32 Dietary Reference Intake (DRI) Dietary Reference Intake (DRI) è un insieme di raccomandazioni nutrizionali dell'Institute of Medicine (IOM) della US National Academy of Sciences. Il sistema di DRI è utilizzato sia dagli Stati Uniti che in Canada ed è destinato al grande pubblico e gli operatori sanitari. Le applicazioni riguardano: Composizione delle diete per le scuole, carceri, ospedali o case di cura Industrie che sviluppano nuovi prodotti alimentari Organi politici di salute e funzionari della sanità pubblica Il DRI è stato introdotto nel 1997 al fine di ampliare le linee guida esistenti note come Recommended Dietary Indennità (RDA - Food and Nutrition Board Committee, 1941). I valori DRI non sono attualmente utilizzati per l'alimentazione di etichettatura. Fabbisogno di nutrienti I nutrienti considerati sono: vitamine e minerali macronutrienti elementi in traccia (es., ferro, zinco) elettroliti e acqua

33 Fabbisogno di nutrienti Le attuali DRI comprendono: Estimated Average Requirement (EAR) Valore di assunzione giornaliero di un nutriente che si stima possa soddisfare il bisogno della metà degli individui di una data popolazione, divisa per stadio di vita e sesso. Reference Daily Intake (RDI) Livello di assunzione giornaliera media sufficiente a coprire il bisogno di quasi tutti gli individui sani (97-98%) appartenenti ad qualsiasi stadio di vita o di sesso. Si calcola sulla base dellEAR ed è di solito circa il 20% in più rispetto l'AER. Tolerable Upper Intake Level (UL) Valore più elevato di assunzione di un nutriente che, verosimilmente, non dà rischi di effetti indesiderati per quasi tutti gli individui di una popolazione. Adeguate Intake (AI) dove non è stato definito un vero e proprio RDA, e il valore stabilito non è strettamente adeguato a tutti nel gruppo demografico.

34 Fabbisogno di nutrienti L'equazione per il calcolo della RDA è: RDA = 1,2 × EAR Questo livello di assunzione statisticamente rappresenta il 97,5 % del fabbisogno della popolazione

35 Fabbisogno di nutrienti LARN (Livelli di Assunzione Raccomandati di Nutrienti per la popolazione italiana) Queste tavole nel nostro Paese prendono il nome di LARN (Livelli di Assunzione Raccomandati di Nutrienti per la popolazione italiana) e sono state compilate con il concorso di diversi organismi (SINU, Ministero della Sanità, INRAN). Indicano, per ciascun nutriente ritenuto indispensabile, un livello di fabbisogno differenziato per diverse classi di età e di sesso, relativo allindividuo standard, e a situazioni particolari come la gravidanza e l'allattamento. Le quantità raccomandate di nutrienti vengono indicate come quantità giornaliere. Le raccomandazioni per ogni gruppo di popolazione sono stilate in base ai fabbisogni medi. I nutrienti considerati sono: energia, proteine, calcio, fosforo, magnesio, ferro, iodio, zinco, tiamina, (vitamina B 1 ), riboflavina (vitamina B 2 ), niacina (vitamina PP), vitamina B6, folacina, vitamina B12, acido ascorbico (vitamina C), vitamina D e vitamina E, acidi grassi essenziali, carboidrati.

36 Fabbisogno di nutrienti

37 I LARN mirano essenzialmente a: proteggere lintera popolazione dal rischio di carenze nutrizionali; fornire elementi utili per valutare ladeguatezza nutrizionale della dieta media della popolazione o di gruppi di essa rispetto ai valori proposti; pianificare la politica degli approvvigionamenti alimentari nazionali, nonchè lalimentazione di comunità. Diverse altre applicazioni delle raccomandazioni sono tuttavia possibili e sono state finora realizzate, quale ad esempio quella della informazione ed educazione alimentare, quella delletichettatura nutrizionale dei prodotti alimentari e quella della formulazione di supplementi o alimenti dietetici.

38 Fabbisogno di nutrienti I valori delle raccomandazioni non rappresentano un limite minimo al di sotto del quale esiste un reale rischio di malnutrizione, nè che necessariamente rappresentano un livello ottimale di assunzione, quanto piuttosto che rappresentano un livello di sicurezza valido per lintera popolazione o per gruppi di essa e non per individui singoli. Inoltre, le quantità raccomandate, anche se si riferiscono a valori per persona per giorno, non debbono essere necessariamente assunte ogni giorno, ma rappresentano una media dei consumi per un certo periodo di tempo. È infine da sottolineare che le raccomandazione si riferiscono ad individui in buona salute e non possono essere applicate a soggetti con necessità specifiche derivanti da malattie, particolari terapie o diete speciali.

39 Fabbisogno di nutrienti Se si prendono in esame le raccomandazioni per la popolazione Americana, Tedesca, Francese, Inglese e quelle elaborate dalla Commissione Europea, si trovano differenze notevoli nel caso di alcuni vitamine e minerali (vedi tabella 1). Tabella 1 - Livelli raccomandati in diversi Paesi per alcuni nutrienti (per la popolazione adulta maschile) UE Commission of the European Communities, 1993 Regno Unito Department of Health, 1991 Fran cia CNERNA, 1992 Germ ania DGE, 1991 USA National Research Council, 1989 Vit A R.E.( µ g) Vit E T.E.(mg) ~ 10 (0,4 mg/g PUFA) 12 Vit B 1 (mg) 1,11,01,51,41,5 Vit B 2 (mg) 1,51,42,21,82,0 Folati( µ g) Vit B 12 ( µ ) 1,41,53,0 2,0 Vit C(mg) Calcio(mg) Zinco(mg) 9,5 15

40 Fabbisogno di nutrienti CategoriaEt à PesoProteine Acidi grassi essenzialiCalcioFosforoPotassioFerroZinco (anni) (1) (kg) (2) (g) (3) (g) (4) (mg)(mg) (6) (mg) w 6w 3 Lattanti0, , Bambini , Maschi , , , , Femmine /18 (7) , , , (5)* Gestanti 595*5* (8)* 7 Nutrici 705,

41 Fabbisogno di nutrienti CategoriaEt à PesoSelenioIodioTiaminaRiboflavinaNiacina (N.E.)Vit.B 6 Vit.B 12 Vit.CFolatiVit.A (R.E.)Vit.D (anni) (1) (kg) (2) (g)(g) (9) (mg) (mg) (10) (mg) (11) (g) (mg) (g)(g) (13) (g) (15) Lattanti0, ,4 5 0, * Bambini ,60,890, * ,71,0110, ,91,2131,11, Maschi ,11,4151, ,21,6181, ,21,6181, ,21,6181, ,81,6181, * Femmine ,91,2141, ,91,3141, ,91,3141, ,91,3141, ,81,3141, * Gestanti ,6141,32, (12)* 700 (14) 10 * Nutrici ,11,7161,42, *

42 Linee Guida per una sana alimentazione italiana … uno strumento che sia garantito dalle istituzioni scientifiche, che sia aggiornato nei suoi contenuti … e che sia facilmente comprensibile e utilizzabile nonché capace di fornire, accanto a pratiche indicazioni (riassunti particolarmente nei come comportarsi, nelle false credenze su..., ecc.), anche informazioni di carattere più spiccatamente tecnico- scientifico. Consumare una dieta adeguata variando i cibi il più possibile Consumare meno grassi, specialmente saturi Adattare lassunzione di energia al suo consumo Utilizzare in maggiori quantità polisaccaridi e fibra (cereali, ortaggi e frutta) Diminuire luso di sale Utilizzare poco (o per nulla) le bevande alcoliche. Fabbisogno di nutrienti

43 Fabbisogno di nutrienti


Scaricare ppt "Alimentazione e Nutrizione Il bisogno di nutrimento è dovuto alla necessità da un lato di avere a disposizione una sufficiente quantità di energia e dallaltro."

Presentazioni simili


Annunci Google