La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

LOrganizzazione Strutturale delle Proteine: dalla Termodinamica alla Bioinformatica Prof. Mauro Fasano

Presentazioni simili


Presentazione sul tema: "LOrganizzazione Strutturale delle Proteine: dalla Termodinamica alla Bioinformatica Prof. Mauro Fasano"— Transcript della presentazione:

1 LOrganizzazione Strutturale delle Proteine: dalla Termodinamica alla Bioinformatica Prof. Mauro Fasano

2 Proteine Composti polimerici formati per condensazione di aminoacidi La traduzione funzionale del messaggio codificato allinterno della cellula

3 I sistemi viventi seguono una logica molecolare Una cellula è un sistema isotermo di molecole, in grado di autoassemblarsi e autoperpetuarsi, che estrae energia libera e materiali grezzi dal suo ambiente. Nella cellula avvengono reazioni chimiche regolate da catalizzatori che essa stessa produce. La cellula mantiene il suo stato stazionario di non- equilibrio rispetto allambiente attraverso il massimo risparmio energetico.

4 I sistemi viventi seguono una logica molecolare Lautoreplicazione è consentita da un sistema che contiene linformazione codificata in modo lineare ed in grado di ripararsi. Linformazione lineare è sufficiente a definire una struttura tridimensionale che determina la funzione biologica. La struttura tridimensionale delle biomolecole e dei complessi supramolecolari è stabilizzata dalla sinergia di interazioni deboli (non covalenti) che agiscono in modo cooperativo.

5 Un semplice dipeptide

6 Ci sono venti aminoacidi diversi

7

8

9

10

11

12 Una proteina è una combinazione di N aminoacidi presi tra 20 possibili? NO! Una proteina è caratterizzata da una precisa forma nello spazio che ne garantisce la funzione (Folding)

13 La struttura di una proteina può essere descritta attraverso quattro livelli di organizzazione

14 Primo livello: la sequenza (struttura primaria) formata da legami covalenti Phe-Leu-Ser-Cys-Pro-Gly FLSCPG

15 Secondo livello: lorganizzazione nello spazio dello scheletro della catena attraverso legami idrogeno

16 Che cosè il legame idrogeno?!?

17 Legame idrogeno

18 Quale conformazione dello scheletro permette di ottenere il maggior numero di legami idrogeno?

19 Due conformazioni prevalenti: α-elica e foglietto β

20 Quale delle due? Alcuni aminoacidi preferiscono assumere una delle due strutture Alcuni aminoacidi non possono assumere una delle due strutture Abbiamo considerato solo lo scheletro!!

21 Terzo livello: linterazione nello spazio di elementi di struttura secondaria attraverso legami non covalenti Interazioni elettrostatiche Interazioni dipolari Forze di dispersione Effetto idrofobico Unica eccezione covalente: il ponte disolfuro

22 Energie di legame Covalente > 300 kJ/mol Non covalente: –ioniche –legame idrogeno20 –dipolo-dipolo –London< 1

23 Leffetto idrofobico Formazione di un clatrato -Debole contributo entalpico intramolecolare favorevole -Debole contributo entropico intramolecolare sfavorevole -Forte contributo entropico intermolecolare favorevole

24 Quindi...

25 Quarto livello: catene polipeptidiche autonomamente strutturate interagiscono tra loro a formare ununica supramolecola

26 Linterazione tra le subunità in una struttura quaternaria riduce la libertà conformazionale di ciascuna subunità Si formano così interruttori molecolari (trasportatori, recettori, enzimi, ecc.) REGOLAZIONE!!

27 Esempio: il recettore del GABA

28 Possiamo prevedere la struttura di una proteina? Calcolare ab initio: NO, troppi gradi di libertà Allora: Apprendere dallevidenza. È possibile determinare sperimentalmente la struttura delle proteine attraverso metodi fisici (risonanza magnetica nucleare e diffrazione dei raggi X in cristalli singoli)

29 Similarità di struttura e similarità di sequenza Coppie di proteine con struttura simile Coppie di proteine con struttura diversa

30 Similarità di sequenza e omologia TRYI_DROME : ENTK_PIG/8 : THRB_BOVIN : KLK1_MOUSE : CTRA_BOVIN : CTR1_ANOGA : CTRL_HALRU : IIGGSDQLIRNAPWQVSIQISAR----HECGGVIYSKEIIITAGHCLHER-SVTLMKV-----RVGA---QNHNYGG-TLVPVAAY--KVHEQFDSRFLH--- IVGGNDSREGAWPWVVALYYNG----QLLCGASLVSRDWLVSAAHCVYG----RNLEPSKWKAILG--LHMTSNLTSPQIVTRLIDEIVINPHYNRRRKD--- IVEGQDAEVGLSPWQVMLFRKSPQE--LLCGASLISDRWVLTAAHCLLYPPWDKNFTV DDLLVRIGK-HSRTRYERKVEKISMLDK-IYIHPRYNWKEN---- IVGGFNCEKNSQPWQVAVYRFT----KYQCGGILLNVNWVLTAAHCHND-----KYQV-----WLGK-NNFLEDEPSAQHRLVSK--AIPHPDFNMSLLNEHT IVNGEEAVPGSWPWQVSLQDKTG---FHFCGGSLINENWVVTAAHCGVT----TSDVV-----VAGEFDQGSSSEK-IQKLKIAK--VFKNSKYNSLTIN--- VVGGEVAKNGSAPYQVSLQVPGWG---HNCGGSLLNDRWVLTAAHCLVG-HAPGDLMV-----LVGT---NSLKEGG-ELLKVDK--LLYHSRYNLPRFH--- IVGGSNAAAGEFPWQGSLQVRSGTSWFHICGCVLYTTSKALTAAHC LSN--SASSYRL--G---FGMLR-MNNVDGTEQYSSVTS--YTNHPNYNGNAAG--- : 84 : 90 : 95 : 86 : 85 : 85 : 90 TRYI_DROME : ENTK_PIG/8 : THRB_BOVIN : KLK1_MOUSE : CTRA_BOVIN : CTR1_ANOGA : CTRL_HALRU : YDIAVLRLSTP-LTFGLSTRAINLAS---TSP--SGGTTVTVTGWGH----TDNG---ALSDSLQKAQLQIIDRGECASQKFGYGAD-FVGEETI SDIAMMHLEFK-VNYTDYIQPICLPE---ENQVFPPGRICSIAGWGK---VIYQG---SPADILQEADVPLLSNEKCQQQMP-EYN---ITENMM LDRDIALLKLKRP-IELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKAS---TRIR--ITDNMF PQPEDDYSNDLMLLRLKKP-ADITDVVKPIDLPT---EEP--KLGSTCLASGWGS---ITPVKY--EYPDELQCVNLKLLPNEDCAKA---HIEK--VTDDML NDITLLKLSTA-ASFSQTVSAVCLPS---ASDDFAAGTTCVTTGWGL---TRYTNA--NTPDRLQQASLPLLSNTNCKKY---WGTK--IKDAMI NDIGLVRLEQP-VQFSELVQSVEYSE-----KAVPANATVRLTGWGR---TSANG---PSPTLLQSLNVVTLSNEDCNKK---GGDPGYTDVGHL YPNDIAVLRLTSSMDTSSSA VGPSVWLL VERLCRTNMYDQR--MGKTQWRWQHPNNLQKVDMTVLTNSDCSSRWSGISGAT-VNSGHI : 165 : 171 : 186 : 173 : 166 : 165 : 175 TRYI_DROME : ENTK_PIG/8 : THRB_BOVIN : KLK1_MOUSE : CTRA_BOVIN : CTR1_ANOGA : CTRL_HALRU : CAAS----TD-ADACTGDSGGPLVASSQ------LVGIVSWG-YRCADDNYPGVYADVAILRPWI CAGYE--EGG-IDSCQGDSGGPLMCLEN--NRWLLAGVTSFG-YQCALPNRPGVYARVPKFTEWI CAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWG-EGCDRDGKYGFYTHVFRLKKWI CAGDM--DGG-KDTCAGDSGGPLICDGV------LQGITSWGPSPCGKPNVPGIYTRVLNFNTWI CAGA----SG-VSSCMGDSGGPLVCKKN--GAWTLVGIVSWG-SSTCSTSTPGVYARVTALVNWV CTLTK---TG-EGACNGDSGGPLVYEGK------LVGVVNFG-VPCALG-YPDGFARVSYYHDWV CIFE----SG-RSACSGDSGGPLVCGNT------LTGITSWGISSCSGS-YPSVYTRVSSFYNWV : 218 : 230 : 250 : 229 : 223 : 218 : 228 Levoluzione molecolare di proteine omologhe garantisce la conservazione dei residui essenziali per il mantenimento della funzione (e quindi della struttura).

31 Per approfondire... Elementi essenziali di chimica della Vita: Un buon testo a livello di laurea triennale: Voet, Voet, Pratt. Fondamenti di Biochimica. Zanichelli Qualcosa in più sugli aspetti bioinformatici:


Scaricare ppt "LOrganizzazione Strutturale delle Proteine: dalla Termodinamica alla Bioinformatica Prof. Mauro Fasano"

Presentazioni simili


Annunci Google