La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Dottorato di ricerca in Biologia Computazionale (XVI ciclo) Dott.ssa Costantini Susan 20 dicembre 2004 Basi molecolari dellattività biologica delle proteine:

Presentazioni simili


Presentazione sul tema: "Dottorato di ricerca in Biologia Computazionale (XVI ciclo) Dott.ssa Costantini Susan 20 dicembre 2004 Basi molecolari dellattività biologica delle proteine:"— Transcript della presentazione:

1 Dottorato di ricerca in Biologia Computazionale (XVI ciclo) Dott.ssa Costantini Susan 20 dicembre 2004 Basi molecolari dellattività biologica delle proteine: lapproccio computazionale e bioinformatico alla comprensione della relazione Struttura-Funzione Basi molecolari dellattività biologica delle proteine: lapproccio computazionale e bioinformatico alla comprensione della relazione Struttura-Funzione

2 Sequenza – Struttura - Funzione Strutture-proteine Genoma MYSFPNSFRFGWSQAGFQSEMGTPGSEDPNTDWYKWVHDP ENMAAGLVSGDLPENGPGYWGNYKTFHDNAQKMGLKIARL NVEWSRIFPNPLPRPQNFDESKQDVTEVEINENELKRLDE YANKDALNHYREIFKDLKSRGLYFILNMYHWPLPLWLHDP IRVRRGDFTGPSGWLSTRTVYEFARFSAYIAWKFDDLVDE YSTMNEPNVVGGLGYVGVKSGFPPGYLSFELSRRHMYNII QAHARAYDGIKSVSKKPVGIIYANSSFQPLTDKDMEAVEM AENDNRWWFFDAIIRGEITRGNEKIVRDDLKGRLDWIGVN YYTRTVVKRTEKGYVSLGGYGHGCERNSVSLAGLPTSDFG WEFFPEGLYDVLTKYWNRYHLYMYVTENGIADDADYQRPY YLVSHVYQVHRAINSGADVRGYLHWSLADNYEWASGFSMR FGLLKVDYNTKRLYWRPSALVYREIATNGAITDEIEHLNS VPPVKPLRH Sequenze-proteine Funzioni Meccanismo dazione Specificità per ligandi Interazioni proteina-proteina 20 dicembre 2004

3 Struttura tridimensionale delle proteine Metodi Sperimentali Diffrazione ai Raggi X (RX) Risonanza Magnetica Nucleare (NMR) Metodi Computazionali Riconoscimento di fold Folding ab-initio Modellamento Comparativo 20 dicembre 2004

4 Modellamento Comparativo Alta identità di sequenza buon allineamento delle sequenze buoni modelli ottenuti per omologia Permette di costruire il modello 3D di una proteina (target) a partire da proteine omologhe (template), la cui struttura è stata caratterizzata sperimentalmente %. La percentuale di identità di sequenza tra la proteina target e quelle template deve essere superiore al 20-40%. 20 dicembre 2004

5 Il modellamento per omologia richiede lutilizzo di numerosi strumenti bioinformatici e computazionali: - per lestrazione di informazioni da banche dati di sequenze (UNIPROT) e di strutture tridimensionali (PDB) - per il confronto e lallineamento delle sequenze (BLAST e CLUSTAL) - per la costruzione dei modelli strutturali per la proteina in esame (MODELER,QUANTA, INSIGHT) - per la valutazione della loro qualità (PROCHECK e PROSA). Modellamento Comparativo 20 dicembre 2004

6 RICERCA DEL TEMPLATE ALLINEAMENTO MULTIPLO TARGET-TEMPLATE Modellamento comparativo PROTEINA TARGET BLAST CLUSTALW MODELLER VALUTAZIONE DEL MODELLO PROCHECK TARGET: AQYSKRREVQCSVTDSEKRSLVLVPNSMELHAVM…… TEMPLATE: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQN… MODELLO DELLA PROTEINA TARGET A PARTIRE DALLA STRUTTURA TEMPLATE 20 dicembre 2004

7 Scopo della tesi 20 dicembre 2004 Applicazioni di metodi computazionali, già noti, per studiare le proprietà strutturali e funzionali delle proteine. Sviluppo di nuovi strumenti di analisi e predizione, al fine di migliorare quelli già esistenti.

8 Applicazioni dei metodi computazionali 1. Modellamento di complessi tra interleuchine-1 ed i loro recettori. 2. Studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca. 3. Simulazioni, mediante lutilizzo del modellamento comparativo, dei cambiamenti conformazionali che si verificano quando le proteine interagiscono tra loro. 20 dicembre 2004

9 Interleuchina-1 (IL-1) è un mediatore della risposta immunitaria IL-1 IL-1, IL-1, IL-1ra Esistono due recettori: IL-1R I e IL-1R II Lattività biologica di IL-1 conseguenza del binding con il proprio recettore formazione del complesso IL-1/IL-1R. 1. Modellamento di complessi tra interleuchine- 1 ed i loro recettori 20 dicembre 2004

10 Simulazione dei complessi IL-1 /IL-1R I in trota e topo. Predizione della struttura tridimensionale - di IL-1 di spigola e di trota - dei recettori di tipo I (IL-1R I ) di trota e topo. Simulazione del complesso IL-1 (trota)/IL-1R I (topo) al fine di dare una interpretazione a livello molecolare dei dati sperimentali circa lattività biologica di rIL-1 di trota. 1. Modellamento di complessi tra interleuchine- 1 ed i loro recettori 20 dicembre 2004

11 IL-1 di spigola e trota Ricerca dei template con BLAST: IL-1 umana [PDB: 1IOB] IL-1 topo [PDB: 2MIB] IL-1 IL-1 uomotopotrotaspigola uomo (86) 34 (49) 37 (51) topo (49) 32 (50) trota (71) spigola 100 In tabella sono riportate le % di identità di sequenza e tra parentesi le similarità. 20 dicembre 2004

12 N-end C-end -bulge loop IL-1 di trota N-end C-end -bulge loop IL-1 di spigola Entrambi sono caratterizzati da una piccola -elica (5% della sequenza) e da 12 -strand antiparalleli (40% della sequenza), definendo la struttura come mainly-beta con topologia di tipo -trefoil, in accordo con la classificazione di CATH e SCOP. 20 dicembre 2004 PDB: 1K5LPDB: 1OOX

13 IL-1R I di topo e trota Ricerca del template con BLAST: IL-1R I umano [catena B in 1ITB dove è presente il complesso umano] IL-1R I uomotopotrota uomo10064 (81)22 (40) topo (39) trota 100 In tabella sono riportate le % di identità di sequenza e tra parentesi le similarità. 20 dicembre 2004

14 C-end N-end Dominio III Dominio II Dominio I a b IL-1 IL-1R I IL-1 /IL-1R I trota ……anche per topo: è stato simulato il complesso utilizzando IL-1 caratterizzato ai RX [ PDB: 2MIB ] ed IL-1R I modellato per omologia [ PDB: 1OU3 ]. 20 dicembre 2004 IL-1R I di trota PDB: 1OU1

15 Da dati bibliografici …… IL-1 di trota è stata prodotta come proteina ricombinante in Escherichia coli. Test di attività biologica: rIL-1 è risultata capace di aumentare la proliferazione cellulare nelle cellule murine D10.G4.1. Lo stesso livello di proliferazione è stato indotto da rIL-1 umana utilizzandone una quantità 1000 volte più bassa di quella necessaria per rIL-1 di trota. Questo fatto può essere una conseguenza delle differenze strutturali tra IL-1 nei mammiferi e nei pesci. Ciò rende rIL-1 di trota meno affine al recettore (IL-1R I ) di topo. Obiettivo: comprensione a livello molecolare del fenomeno biologico. 20 dicembre 2004

16 Complesso IL-1 trota/IL-1R I topo * Le Energie sono espresse in Kcal/mol Complessi Van der Waals Elettrostatico Energia totale IL-1 ( trota ) / IL-1R I (trota) IL-1 (topo) /IL-1R I (topo) IL-1 (trota) / IL-1R I (topo) IL-1 (trota) / IL-1R I (topo) dicembre 2004 IL-1 IL-1R I

17 Esposizione al solvente degli AA dellIL-1 di trota nei due complessi AAPosizione % esposizione con IL-1R di trota % esposizione con IL-1R di topo Differenze ALA15336,593,3-56,8 SER67,247,7-40,5 GLU116,937,8-30,9 THR11741,669,8-28,2 MET13814,842,4-27,6 SER56,233,7-27,5 GLU916891,8-23,8 GLY3964,387,6-23, ASP14127,210,916,3 GLU6139,723,316,4 PRO5582,965,417,5 ASN16669,850,819 ILE5823,73,520,2 THR8631,511,320,2 THR6038,615,722,9 MET2525,40,924,5 ASN2662,429,632,8 20 dicembre 2004

18 - Risultati - Le interazioni elettrostatiche sono risultate molto ridotte nelleterocomplesso e questa è probabilmente una conseguenza delle differenze amminoacidiche, che provocano una perdita di catene laterali cariche e, quindi, di ponti salini. Lenergia di interazione nelleterocomplesso tra IL-1 (trota) e IL-1R I (topo) è risultata più alta di quella nellomocomplesso, indicando che il legame tra IL-1 di trota ed IL-1R I di topo è molto debole. Misurando lesposizione al solvente degli amminoacidi di IL-1 di trota nellomocomplesso e nelleterocomplesso, abbiamo anche verificato come alcuni residui hanno valori completamente differenti una diversa capacità dellIL-1 di trota di legarsi ai due recettori, in accordo con quanto riportato in letteratura. 20 dicembre 2004 Scapigliati G, Costantini S, Colonna G, Facchiano A, Buonocore F, Bossù P, Cunningham C, Holland JW and Secombes CJ. (2004) Modelling of fish interleukin-1 and its receptor. Dev. Comp. Immunol. 28,

19 La celiachia si manifesta, in individui geneticamente predisposti, in seguito ad ingestione di gliadina, il maggiore costituente del glutine del grano. 2. Studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca Queste molecole legano in modo non covalente i peptidi di gliadina ( ) e li espongono al riconoscimento dei linfociti T (CD4 + ). Essa è associata ai geni dellHLA codificanti per gli eterodimeri DQ2 e DQ8, che sono esposti sulla superficie delle cellule APC (Cellule Presentanti lAntigene). 20 dicembre 2004

20 Un peptide antigenico (peptide di gliadina) si lega in modo più efficace alle molecole DQ2 o DQ8 quando possiede dei residui amminocidici con carica negativa in determinate posizioni di ancoraggio. Sollid LM Ann Rev Immunol 2000: I peptidi di gliadina non hanno molti amminoacidi carichi negativamente. Ma se sono sottoposti a reazioni di deammidazione o nellambiente acido dello stomaco o ad opera della transglutaminasi tissutale, alcuni residui di glutammina sono convertiti in acido glutammico. Recettore Cellule T DQ2 Peptide 20 dicembre 2004

21 2. Studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca Modellamento per omologia della struttura 3D del dimero DQ2, presente in individui celiaci. Simulazione del complesso con vari peptidi di glutine per investigare le basi molecolari di questa interazione. Simulazione degli effetti della deammidazione di residui di glutammina nelle posizioni di ancoraggio e di altre modifiche al fine di dare una spiegazione a livello molecolare di risultati sperimentali relativi allaffinità di questi peptidi per il dimero DQ2. 20 dicembre 2004

22 Domini C-terminali Dominio N-terminale – catena Sito di legame Dominio N-terminale – catena Dimero DQ2 20 dicembre 2004 Le sequenze delle due catene del DQ2 sono state modellate per omologia utilizzando come riferimento quelle del dimero DQ8 (percentuale di identità di sequenza del 91%). PDB: 1NBN

23 P1 P9 | | Peptide PDB LVEALYLVCGERGG Alfa-I QLQPFPQPQLPY Alfa-II PQPQLPYPQPQ Alfa-III PYPQPQLPY Glia-a20 FRPQQPYPQ Glia-g2 PYPQQPQQP Gamma-I PQQPQQSFPQQQRP Gamma-II IIQPQQPAQ Gamma-III FPQQPQQPYPQQP Gamma-IV FSQPQQQFPQPQ Glt-156 PFSQQQQSPF Glt-17 PFSQQQQPV Peptidi di glutine usati nelle simulazioni I residui di glutammina che vengono deammidati sono riportati in rosso. Le sequenze dei peptidi di glutine usati nelle simulazioni sono allineate a quella del peptide di insulina presente nel modello del DQ8 usato come riferimento (template) [ PDB: 1JK8 ]. 20 dicembre 2004

24 Energie di interazione tra il dimero DQ2 ed i peptidi di glutine Le barre rappresentano la differenza di energia di interazione tra il peptide naturale e quelli modificati. Alfa-I Alfa-II Alfa-III Glia-a20 Glia-g2 Gamma-I Gamma-II Gamma-III Glt-156 Gamma-IV Glt dicembre 2004 Alfa-I P6 Gamma-I P-2 P7 P9 QQ Alfa-II P4 Q

25 Dettaglio della superficie del sito di legame del dimero DQ2 con il peptide alfa II. Lys 71 Posizione P7 Posizione P4 Region N-terminale del peptide Regione C-terminale del peptide 20 dicembre 2004

26 - Risultati (1) - La deammidazione dei peptidi nelle posizioni p4, p6 e p7 rende i complessi più stabili. I nostri risultati confermano in gran parte i dati sperimentali riportati in letteratura. La presenza di una carica positiva (Lys) in p6 e p7 nei peptidi riduce la loro affinità per il dimero. I nostri risultati ci danno delle informazioni riguardo altri peptidi (gamma-III, gamma-IV e glt-156) per i quali non ci sono analoghi dati sperimentali: 1. le loro probabili posizioni di ancoraggio. 2. la sostituzione glutammina-glutammico può migliorare linterazione DQ2/peptide per questi peptidi 20 dicembre 2004

27 - Risultati (2) - S. Costantini, G. Colonna, M. Rossi, A.M. Facchiano: Binding of gluten peptides to the coeliac disease-associated HLA-DQ2 molecule by computational methods, In Proceedings of the 8th Gluten Workshop, edited by D. La Fiandra, S. Masci and R. DOvidio, The Royal Society of Chemistry, Cambridge, UK, 2004, pp Susan Costantini, Mauro Rossi, Giovanni Colonna, and Angelo M. Facchiano: "Modelling of HLA-DQ2 and of its interaction with gluten peptides to explain molecular recognition in celiac disease, submitted 20 dicembre 2004

28 3. Simulazioni mediante lutilizzo del modellamento comparativo dei cambiamenti conformazionali che si verificano quando le proteine interagiscono tra loro Ad esempio le IL-1 IL-1 umana da sola [PDB: 1IOB] IL-1 umana complessata con il suo recettore [PDB: 1ITB] 20 dicembre 2004

29 Differenze tra i modelli ottenuti per omologia usando template diversi. 20 dicembre 2004 Se usiamo come template lIL-1 da sola Se usiamo come template lIL-1 complessata Se usiamo come template entrambi i modelli sperimentali di IL-1

30 Confronto tra le due strutture umane di IL-1 riportate nella banca dati PDB. Modello teorico umano ottenuto per omologia utilizzando entrambe le strutture sperimentali (indicato come h-ThM). Simulazione dei complessi del modello sperimentale [PDB: 1IOB] e di quello teorico h-ThM con il recettore, sulla base del complesso sperimentale umano [PDB: 1ITB]. 3. Simulazioni mediante lutilizzo del modellamento comparativo dei cambiamenti conformazionali che si verificano quando le proteine interagiscono tra loro Confronto tra i due complessi teorici e quello sperimentale. 20 dicembre | | | | | | | human APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVAL 1IOB 1ITBA | | | | | | | human GLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNW 1IOB 1ITBA | | | | human YISTSQAENMPVFLGGTKGGQDITDFTMQFVSS 1IOB 1ITBA

31 Complessi ASA allinterfaccia (Å 2 ) Numero di legami ad idrogeno 1IOB/1ITBB ITB h-ThM/1ITBB Energie di interazione tra IL-1 e IL-1R I Complessi ASA allinterfaccia (Å 2 ) Numero di legami ad idrogeno 1IOB/1ITBB ITB h-ThM/1ITBB * ASA è larea di superficie accessibile al solvente allinterfaccia per linterleuchina 20 dicembre 2004

32 - Risultati (1) - Le differenze conformazionali tra i due modelli sperimentali di IL-1 hanno effetto sullinterazione con il recettore. Il complesso con h-ThM risente del fatto che è stato ottenuto da entrambe le strutture sperimentali. La migliore interazione è quella relativa al complesso sperimentale. L interazione nel complesso con h-ThM è migliore di quella nel complesso con 1IOB. 20 dicembre 2004

33 Simulazione dellinterazione IL-1 /IL-1R I in trota e topo: Modellamento per omologia delle sequenze di IL-1 di topo e trota usando come template i due modelli sperimentali umani, 1IOB e 1ITBA. trota t-ThF e t-ThC topo m-ThF e m-ThC Simulazione per ciascun organismo dei complessi tra il recettore ed i due modelli di IL-1 ottenuti. trota t-ThCOMPL-F e t-ThCOMPL-C topo m-Th COMPL-F e m-ThCOMPL-C 20 dicembre 2004

34 Energie di interazione IL-1 /IL-1R I nei complessi in topo e trota I complessi ottenuti usando lIL-1 umana nella forma complessata (t-ThCOMPL-C e m-ThCOMPL-C) hanno valori di energia di interazione più favorevoli. m-ThCOMPL-F t-ThCOMPL-F t-ThCOMPL-C m-ThCOMPL-C 20 dicembre 2004

35 ASA allinterfaccia (Å 2 ) Numero di legami ad idrogeno Complessi in topo m-ThCOMPL-F m-ThCOMPL-C Complessi in trota t-ThCOMPL-F t-ThCOMPL-C Complessi in topo e trota Le conformazioni di IL-1 di topo e trota, ottenute utilizzando come riferimento la struttura sperimentale della proteina umana nella sua forma complessata, sono quelle più adatta ad interagire con il recettore. 20 dicembre 2004

36 Il modellamento comparativo può essere applicato con migliori risultati per predire i modelli di proteine, che devono essere utilizzati per approfondire studi di interazione proteina-proteina, quando come riferimento viene utilizzata la struttura tridimensionale di una proteina omologa nello stato complessato. - Risultati (2) - 20 dicembre 2004 Susan Costantini, Giovanni Colonna and Angelo M. Facchiano: Comparative modelling simulates conformational changes occurring in protein-protein interaction, submitted.

37 Scopo della tesi 20 dicembre 2004 Sviluppo di nuovi strumenti di analisi e predizione, al fine di migliorare quelli già esistenti. Applicazioni di metodi computazionali, già noti, per studiare le proprietà strutturali e funzionali delle proteine.

38 Sviluppo di nuovi strumenti di analisi e predizione a. Propensità degli amminoacidi per i vari tipi di struttura secondaria in proteine che appartengono a differenti classi strutturali. b. Frequenze di coppie di amminoacidi nelle proteine. 20 dicembre 2004

39 a. Propensità degli amminoacidi La struttura secondaria è stata assegnata mediante il programma DSSP considerando H, G ed I come eliche, B ed E come struttura beta e le altre come coil. Set di 2168 proteine derivato dalla lista PDBselect (non ridondante e con percentuale di identità di sequenza minore del 25%). Le propensità degli amminoacidi nei differenti tipi di struttura secondaria (Pij) rapporto tra la frequenza con cui un dato residuo si trova in eliche, -strand e coil rispetto alla frequenza con cui tale residuo si trova nel set di proteine considerato. dove n ij è il numero dei residui di tipo i in struttura di tipo j, n i è il numero totale di residui di tipo i, N j è il numero totale di residui in struttura di tipo j ed N T è il numero totale di residui. 20 dicembre 2004

40 Predizione della struttura secondaria AELMDPRSTWMNALEATGFQE ………… valore più alto tra,, A partire dalla regione N-terminale di ogni sequenza proteica, noi abbiamo considerato una running window di n amminoacidi Queste propensità sono state calcolate usando finestre di lunghezza differente per i tre tipi di struttura secondaria (w, w, w c ), che sono state, poi, moltiplicate per differenti coefficienti (coeff, coeff, coeff c ). Per n=7 con, e indichiamo il valore medio delle propensità in elica, -strand e coil. 20 dicembre 2004

41 Resubstitution test Gli elementi di struttura secondaria per ciascuna proteina nel set studiato vengono predetti usando le propensità derivate dallo stesso set. Jackknife test Gli elementi di struttura secondaria per ciascuna proteina test vengono predetti dalle propensità calcolate da un set di proteine che include tutte tranne la stessa proteina test. La qualità delle nostre predizioni è stata valutata …….. 20 dicembre 2004

42 Metodi Q Q Q coil Q3Q3Q3Q3 Resubstitution test Jackknife test Chou e Fasman Accuratezza predittiva dove Q, Q e Q coil sono rispettivamente le percentuali di residui predetti correttamente in eliche, -strand e coil; Q 3 è la percentuale totale di residui predetti correttamente.Metodi dove k rappresenta le regioni in elica, beta e coil nella proteina, n k è il numero di residui predetti correttamente nello stato k e N k è il numero totale di residui nello stato conformazionale k nella proteina. dove N T è il numero totale di residui nella proteina ed N x è il numero totale di residui predetti in modo non corretto nella proteina. 20 dicembre 2004

43 Assegnazione classe strutturale Secondo Nakashima et al.(1986) Proteine alfa: contenuto di eliche >15% e -strand <10% Proteine beta: contenuto di eliche 10% Proteine alfa-beta:contenuto di eliche >15% e -strand >10% Secondo Chou (1995) Proteine alfa: contenuto di eliche >40% e -strand <5% Proteine beta: contenuto di eliche 40% Proteine alfa-beta:contenuto di eliche >15% e -strand >15% 20 dicembre 2004

44 Per ogni classe: Propensità degli amminoacidi nei tre tipi di struttura secondaria (eliche, -strand e coil). Predizione degli elementi di struttura secondaria: resubstitution test jackknife test Valutazione dellaccuratezza predittiva. Confronto con le predizioni di Chou e Fasman. 20 dicembre 2004

45 Accuratezza predittiva Classificazione secondo Nakashima et al. (1986) Classi Q Q Q coil Q3Q3Q3Q3 Alfa Resubstitution test Jackknife test Chou e Fasman Classi Q Q Q coil Q3Q3Q3Q3 Alfa (627) Resubstitution test Jackknife test Chou e Fasman Beta Resubstitution test Jackknife test Chou e Fasman Beta (552) Resubstitution test Jackknife test Chou e Fasman Alfa-beta Resubstitution test Jackknife test Chou e Fasman Alfa-beta (912) Resubstitution test Jackknife test Chou e Fasman dicembre 2004

46 Accuratezza predittiva Classificazione secondo Chou (1995) Classi Q Q Q coil Q3Q3Q3Q3 Alfa Resubstitution test Jackknife test Chou e Fasman Classi Q Q Q coil Q3Q3Q3Q3 Alfa (470) Resubstitution test Jackknife test Chou e Fasman Beta Resubstitution test Jackknife test Chou e Fasman Beta (167) Resubstitution test Jackknife test Chou e Fasman Alfa-beta Resubstitution test Jackknife test Chou e Fasman Alfa-beta (696) Resubstitution test Jackknife test Chou e Fasman dicembre 2004

47 - Risultati (1) - Le propensità degli amminoacidi sono differenti nelle tre classi strutturali (alfa, beta ed alfa-beta). Se per una data proteina può essere assegnata la classe strutturale, gli elementi di struttura secondaria per quella proteina possono essere predetti con migliori risultati, usando le propensità degli amminoacidi calcolate per la sua stessa classe e valori ottimizzati di coefficienti e finestre. 20 dicembre 2004

48 Nellambito di questo studio è stato necessario sviluppare dei software che automaticamente e velocemente fossero in grado di analizzare un numero così alto di proteine. 20 dicembre Risultati (2) - Susan Costantini, Giovanni Colonna and Angelo M. Facchiano: The amino acid conformation potentials in proteins belonging to different secondary structural classes, in preparation.

49 Frequenza dei doppietti valutata come rapporto tra il numero di volte in cui il residuo x si trova vicino a quello a, x(a), ed il numero totale di coppie possibili (ntot) b. Frequenze di coppie di amminoacidi nelle proteine Utilizzando il set di 2168 proteine, suddiviso nelle tre classi strutturali Per le proteine, classificate secondo Nakashima et al. (1986), alfa AA, AL, EL, LA, LE ed LK, beta SG, GK, DG, VT e GS alfa-beta AA, AL, LA, LL 20 dicembre 2004

50 È possibile sfruttare questa informazione per predire la Classe Strutturale di proteine? I doppietti AA, AL, LA, LE ed LL sono più frequenti nelle proteine alfa che in quelle beta ed alfa-beta. I doppietti GS, SG, SS, VT, TV sono più presenti nelle proteine beta. 20 dicembre 2004 Confrontando le frequenze dei doppietti nelle tre classi :

51 Predizione della Classe Strutturale Per ciascuna proteina è stata predetta la classe strutturale, utilizzando il metodo della regressione lineare. Sono stati calcolati i coefficienti di correlazione tra linsieme dei valori relativi alle frequenze delle coppie di residui per la proteina in esame e per le proteine classificate come alfa, beta ed alfa-beta. Frequenze dei doppietti: Alfa Beta Alfa-beta Proteina in esame r x/alfa r x/beta r x/alfa-beta La classe strutturale è assegnata in base al valore più alto tra i tre coefficienti. 20 dicembre 2004

52 65% Accuratezza predittiva Proteine class Proteine pred Q%jackknife Nakashima alfa beta alfa-beta Choualfa beta alfa-beta % 20 dicembre 2004

53 I risultati ottenuti dalle predizioni di classe strutturale sono incoraggianti, anche perché si basano solo sulle frequenze dei doppietti nelle proteine. - Risultati - Dalla sola sequenza amminoacidica di una proteina, è possibile ottenere sempre più informazioni riguardo il suo fold. Questo studio può essere molto utile per migliorare laccuratezza dei metodi di predizione di struttura secondaria. 20 dicembre 2004

54 Il lavoro svolto suggerisce come lapplicazione dei metodi computazionali sia ormai diventata di estrema utilità per fornire chiarimenti strutturali e funzionali riguardo le proteine e per formulare ipotesi sulla loro attività biologica, anche se qualunque applicazione pratica di quanto ipotizzato può essere realizzata solo mediante ulteriori studi di tipo sperimentale. - Conclusioni - Questo lavoro mostra la necessità di sviluppare sempre nuovi strumenti di analisi e di predizioni, capaci di migliorare quelli esistenti, anche nella prospettiva di dover gestire limpressionante quantità di informazioni, derivate dalla ricerca genomica e proteomica. 20 dicembre 2004

55 Comunicazioni a Congressi Susan Costantini, Angelo M. Facchiano, Giovanni Colonna: Prediction of the three-dimensional structures of proteins by Homology Modelling, Gruppo di Cooperazione Bioinformatica tra il 15 e il 17 marzo S. Costantini, A.M. Facchiano, G. Colonna: Metodi computazionali e bioinformatici per la predizione della struttura tridimensionale di proteine, Giornate Scientifiche della Facoltà di Medicina, Seconda Università di Napoli, 4-6 giugno S. Costantini, G. Colonna, A.M. Facchiano: Coeliac disease: studying the interaction of HLA-DQ2 molecule with gluten peptides by computational methods, Meeting Gruppo di Cooperazione Bioinformatica - Frascati – March 28-29, Costantini S., Facchiano A.M. and Colonna G.: Studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca mediante metodi computazionali, Giornate Scientifiche della Facoltà di Medicina, 4-6 giugno Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: Folding ab-initio di proteine: un approccio topologico, Giornate Scientifiche della Facoltà di Medicina, Seconda Università di Napoli, 4-6 giugno Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: Computational issues of a topological approach to protein folding, Sheffield, July Susan Costantini, Giovanni Colonna, Mauro Rossi and Angelo M. Facchiano: Binding of gluten peptides to the celiac disease associated HLA-DQ2 molecule by computational methods, 8th Gluten Workshop, Viterbo, 8-10 settembre Costantini S., Facchiano A.M. and Colonna G.: Analysis of the three-dimensional structure of Il-1beta/IL-1 receptor complexes by computational methods, SIB2003, Ferrara, Settembre Susan Costantini, Giovanni Colonna and Angelo M. Facchiano: Comparative modelling for predicting the different conformations assumed by a protein during its different activities, Bits 2004, Padova March Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: A geometrical approach for protein secondary structure simulations: computational issues, 2-5 April 2004, Neuchatel, Switzerland. S. Costantini, G. Colonna and A.M. Facchiano: Comparative modelling for predicting the different conformations assumed by a protein during its different activities, SIB-Proteine 2004, Viterbo May E. Randelli, M. Forlenza, S. Meloni, S. Benedetti, C.J. Secombes, J. Zou, G. Scapigliati, S. Costantini, A. Facchiano, F. Buonocore: Potential application of sea bass recombinant interleukin-1 in fish vaccination, SIB-Proteine Costantini S., Facchiano A.M., Rossi M., Colonna G.: Metodi computazionali per lo studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca, Giornate Scientifiche della Facoltà di Medicina, 9-11 giugno Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: Un approccio ab-initio per la simulazione di strutture secondarie di proteine, Giornate Scientifiche della Facoltà di Medicina, 9-11 giugno Angelo M. Facchiano, Susan Costantini, Mauro Rossi, Giovanni Colonna: Simulation of the Interaction of Gluten Peptides with HLA-DQ2 Molecule to Investigate the Molecolar Basis of Coeliac Disease ISMB-ECCB 2004, Glasgow, Scotland, UK, July 31- August 4, Susan Costantini, Giovanni Colonna, Angelo M. Facchiano: Prediction of the secondary structure of proteins: the amino acid propensities in proteins belonging to deifferent secondary structural classes, Nettab 2004 – Network Tools and Applications in Biology, Camerino, Italy, September 5-7, Comunicazioni a Congressi Susan Costantini, Angelo M. Facchiano, Giovanni Colonna: Prediction of the three-dimensional structures of proteins by Homology Modelling, Gruppo di Cooperazione Bioinformatica tra il 15 e il 17 marzo S. Costantini, A.M. Facchiano, G. Colonna: Metodi computazionali e bioinformatici per la predizione della struttura tridimensionale di proteine, Giornate Scientifiche della Facoltà di Medicina, Seconda Università di Napoli, 4-6 giugno S. Costantini, G. Colonna, A.M. Facchiano: Coeliac disease: studying the interaction of HLA-DQ2 molecule with gluten peptides by computational methods, Meeting Gruppo di Cooperazione Bioinformatica - Frascati – March 28-29, Costantini S., Facchiano A.M. and Colonna G.: Studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca mediante metodi computazionali, Giornate Scientifiche della Facoltà di Medicina, 4-6 giugno Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: Folding ab-initio di proteine: un approccio topologico, Giornate Scientifiche della Facoltà di Medicina, Seconda Università di Napoli, 4-6 giugno Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: Computational issues of a topological approach to protein folding, Sheffield, July Susan Costantini, Giovanni Colonna, Mauro Rossi and Angelo M. Facchiano: Binding of gluten peptides to the celiac disease associated HLA-DQ2 molecule by computational methods, 8th Gluten Workshop, Viterbo, 8-10 settembre Costantini S., Facchiano A.M. and Colonna G.: Analysis of the three-dimensional structure of Il-1beta/IL-1 receptor complexes by computational methods, SIB2003, Ferrara, Settembre Susan Costantini, Giovanni Colonna and Angelo M. Facchiano: Comparative modelling for predicting the different conformations assumed by a protein during its different activities, Bits 2004, Padova March Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: A geometrical approach for protein secondary structure simulations: computational issues, 2-5 April 2004, Neuchatel, Switzerland. S. Costantini, G. Colonna and A.M. Facchiano: Comparative modelling for predicting the different conformations assumed by a protein during its different activities, SIB-Proteine 2004, Viterbo May E. Randelli, M. Forlenza, S. Meloni, S. Benedetti, C.J. Secombes, J. Zou, G. Scapigliati, S. Costantini, A. Facchiano, F. Buonocore: Potential application of sea bass recombinant interleukin-1 in fish vaccination, SIB-Proteine Costantini S., Facchiano A.M., Rossi M., Colonna G.: Metodi computazionali per lo studio della struttura e dellinterazione tra le proteine coinvolte nella malattia celiaca, Giornate Scientifiche della Facoltà di Medicina, 9-11 giugno Ceci G., Mucherino A., DApuzzo M., di Serafino D., Costantini S., Facchiano A.M. and Colonna G.: Un approccio ab-initio per la simulazione di strutture secondarie di proteine, Giornate Scientifiche della Facoltà di Medicina, 9-11 giugno Angelo M. Facchiano, Susan Costantini, Mauro Rossi, Giovanni Colonna: Simulation of the Interaction of Gluten Peptides with HLA-DQ2 Molecule to Investigate the Molecolar Basis of Coeliac Disease ISMB-ECCB 2004, Glasgow, Scotland, UK, July 31- August 4, Susan Costantini, Giovanni Colonna, Angelo M. Facchiano: Prediction of the secondary structure of proteins: the amino acid propensities in proteins belonging to deifferent secondary structural classes, Nettab 2004 – Network Tools and Applications in Biology, Camerino, Italy, September 5-7, 2004.

56 Tutor: Prof. Giovanni Colonna Dott. Angelo Facchiano - SUN - ISA-CNR, Avellino Dott. Francesco Buonocore Università della Tuscia - Ringraziamenti - Dott. Mauro Rossi ISA – CNR, Avellino 20 dicembre 2004 Marilù Chiusano Gruppo di Bioinformatica dellISA-CNR, Avellino Gruppo di ricerca del prof. Malorni del CESMA-ProBio, Avellino Marilù Chiusano Gruppo di Bioinformatica dellISA-CNR, Avellino Gruppo di ricerca del prof. Malorni del CESMA-ProBio, Avellino


Scaricare ppt "Dottorato di ricerca in Biologia Computazionale (XVI ciclo) Dott.ssa Costantini Susan 20 dicembre 2004 Basi molecolari dellattività biologica delle proteine:"

Presentazioni simili


Annunci Google