La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Fisica Computazionale applicata alle Macromolecole Pier Luigi Martelli Università di Bologna 051 2094005 338 3991609 Metodi di allineamento.

Presentazioni simili


Presentazione sul tema: "Fisica Computazionale applicata alle Macromolecole Pier Luigi Martelli Università di Bologna 051 2094005 338 3991609 Metodi di allineamento."— Transcript della presentazione:

1 Fisica Computazionale applicata alle Macromolecole Pier Luigi Martelli Università di Bologna Metodi di allineamento

2 Ricordiamo... La struttura di una proteina in ambiente fisiologico dipende solo dalla sua sequenza amminoacidica Esperimento di Anfinsen Differenti sequenze amminoacidiche assumono in ambiente fisiologico lo stesso fold Banche dati CATH e SCOP: Organizzazione gerarchica La funzione dipende dalla struttura, sebben questa relazione non sia rigorosa La funzione dipende da tutta la struttura, non solo dal fold

3 Problema Determinare il fold a partire dalla sequenza amminoacidica Allineare le sequenze in modo da riprodurre lallineamento generato dalla sovrapposizione delle loro due struttureStrategia Esaminare come le sequenze hanno avuto origine Perché nei vari organismi esistono sequenze differenti per una unica funzione?

4 Evoluzione Molecolare e omologia Evoluzione: Mutabilità e Selezione Naturale Le sequenze degli organismi attuali hanno avuto origine dallevoluzione di sequenze ancestrali Le sequenze genomiche cambiano continuamente in modo casuale Lambiente seleziona gli individui in base al loro fenotipo Se il prodotto del gene modificato non è funzionale (perde struttura o funzione) lindividuo muore e la modifica non si trasmette NB. Le mutazioni sono casuali? Almeno la loro velocità, non sempre: SOS polimerasi di Radman

5 Evoluzione Molecolare e omologia Omologia Due sequenze sono dette omologhe se hanno un ancestore comune Ortologhe in due specie differenti Paraloghe allinterno della stessa specie (duplicazione genica) Similarità Due sequenze sono dette simili se condividono buona parte della sequenza (molti amminoacidi uguali o simili): concetto NON evolutivo, ma di confronto tra sequenze

6 Omologia e Similarità Sequenze omologhe sono sempre simili? Dipende dal grado di divergenza Sequenze simili sono sempre omologhe? Sequenze differenti possono essere evolute convergentemente verso sequenze simili (es., non su sequenze, ali di uccelli e ali di pipistrello sono evoluzioni convergenti, a partire da da rettili e da mammiferi) Di principio similarità e omologia non coincidono esattamente. Tuttavia se due sequenze sono molto simili sono probabilmente omologhe. Per ora misuriamo la similarità in termini di identità di sequenza

7 Identità di sequenza e identità strutturale Quando la similarità di sequenza implica similiarità strutturale?

8 Chothia, C. & Lesk, A. M. (1986). The relation between the divergence of sequence and structure in proteins. EMBO J. 5, Identità di sequenza e identità strutturale Rmsd of backbone atoms in core Percent identical residues in core Percent identical residues in core Fraction of residues in core with RMSD < 0.1 nm Fino a quanto due sequenze simili danno strutture uguali? 2 proteine sono sovrapposte e si esamina la percentuale di identità nel nucleo sovrapposto Proteine con identità maggiore del 60% hanno il 90% dei residui sovrapposti a meno di 0.1 nm

9 identity Numero di residui allineati Identità di sequenza (%) Identità di sequenza implica identità strutturale Identità di sequenza e identità strutturale Identità di sequenza NON implica identità strutturale Rost B (1999). The twilight zone of protein alignments. Protein Engineering 12,

10 . Identità di sequenza e identità strutturale Quindi due sequenze più lunghe di 100 residui, che condividano il 30 % dei residui, hanno struttura simile Per sequenze più corte la percentuale di identità deve essere più alta Questo NON implica che sequenze con identità minore abbiano strutture differenti Esempio: Mioglobina di capodoglio e emoglobina batterica: RMSD = 0.19 nm, Identità: 14%

11 Identità di sequenza e identità strutturale Per sequenze più lunghe di 100 residui Midnight zone: contiene la maggior parte delle proteine strutturalmente simili Twilight zone: alto numero di falsi positivi (sequenza simile struttura diversa) Safe zone: nessun falso positivo tutte le sequenze simili hanno la stessa struttura 20%30% Percentuale di identità

12 Allineamento di sequenze Problema: date due sequenze, confrontarle in modo da rilevare la loro similarità Definire una distanza tra le sequenze Cercare un algoritmo per trovare lallineamento a minima distanza Studiare metodi per validare la significativicità dellallineamento

13 Distanza tra sequenze Quali eventi consideriamo? Mutazione Va definito un punteggio per la sostituzione dellamminoacido i con lamminoacido j Matrici di sostituzione s(i,j) A: ALASVLIRLITRLYP B: ASAVHLNRLITRLYP La matrice di sostituzione riflette se una mutazione è mediamente compatibile col folding e col mantenimento della funzione

14

15 Derivazione degli score da allineamenti di sequenze omologhe Vogliamo misurare la probabilità di mutazione di ogni tipo di amminoacido in un insieme di sequenze omologhe Date (molte) coppie di sequenze correlate, misuriamo la frequenza della sostituzione i A ->j B o i B ->j A (indipendente dalla direzione): P ij Es: A: ALASVLIRAILRLYP B: ALAVLLNRLILRALP P(A,A)= N(A A,A B )/N = 2/15 P(A,L)= P(L,A)= [N(L A,A B )+N(A A,L B )]/N = 2/15

16 Qual è la probabilità che la sostituzione i->j sia casuale (e quindi non significativa)? La sostituzione è significativa? Es: 1° insieme di sequenze omologhe A: ALASVLIRAILRLYP B: ALAVLLNRLILRALP La probabilità che questa sostituzione sia casuale dipende dalle frequenze di occorrenza dei singoli amminoacidi P i e P j 2° insieme di sequenze omologhe A: LLLLAALLLALLALL B: LALLAALLAALLALL P(A,L)= 2/15 in entrambi i casi. Sono ugualmente significativi?

17 Per determinare il grado di non casualità della sostituzione bisogna confrontare P ij con il prodotto P i P j Es: 1° insieme di sequenze omologhe A: ALASVLIRAILRLYP B: ALAVLLNRLILRALP P(A)= 6/30, P(L) =10/30 P(A,L) = 2/15 > 1/15 = P(A)P(L): sostituzione FAVORITA 2° insieme di sequenze omologhe A: LLLLAALLLALLALL B: LALLAALLAALLALL P(A)= 10/30, P(L) =20/30 P(A,L) = 2/15 < 2/9 = P(A)P(L): sostituzione SFAVORITA Sostituzione i A -> j B casuale significa che i 2 eventi: E 1 = (i in A) e E 2 = (j in B) sono INDIPENDENTI Confronto con lipotesi di indipendenza

18 SCORE di SOSTITUZIONE: s(i,j) =int[K log(P ij /P i P j )] Il logaritmo rende la quantità additiva sulla sequenza Minima distanza = Massimo score (s) Score di sostituzione Il rapporto r ij = P ij /P i P j determina se la sostituzione i -> j è più o meno frequente di quanto ci si aspetterebbe casualmente. Dato un allineamento tra due sequenze: A: SLDPIKHTYRALMNVDSLRTFPIL B: SFGIKKHTKLAKLPVDTIKSWPIL la probabilità di sostituzione A->B sarà data dal prodotto degli r ij : r SS r LF r DG r PI r IK … (indipendenza delle posizioni)

19 ESERCIZIO Calcolare la matrice di sostituzione a partire dalle seguenti sequenze allineate ACAGGTGGACCT ACTGGTCGACTT CTATATGG CCGGATCG

20 Matrici di sostituzione: PAM In base a questo concetto, differenti matrici possono essere derivate. La differenza fondamentale sta nellinsieme di allineamenti considerati per costruire le matrici. PAMx: (Point Accepted Mutation). Numero di eventi mutazionali pari a x%. Si costruisce la matrice: A 1 ij = P(j|i) = N(i,j)/N(i) per sequenze con 1% di mutazioni. PAM 1 = Log(A 1 ij /P i )

21 A n ij =(A 1 ij ) n Es: n=2 P(i|j) = l P(i|l) P(l|j) NOTA BENE: n % eventi mutazionali: numero di mutazioni, NON di residui mutati. Possono essere rimutati posizioni già mutate. 100 eventi mutazionali indipendenti ogni 100 residui lasciano alcune posizioni invariate PAM n = Log(A n ij /P i ) Matrici di sostituzione: PAM Per derivare gli score relativi a sequenze in cui siano avvenuti n eventi mutazionali ogni 100 residui:

22 Relazione tra PAM e identità tra due sequenze Il numero di eventi mutazionali (PAM) è differente dal numero di residui differenti tra due sequenze, quando le mutazioni si accumulano.

23 PAM10 Matrice molto stringente: nessun valore positivo fuori diagonale

24 PAM160 Iniziano valori positivi fuori diagonale: residui con valori di sostituzione positivi sono detti SIMILI

25 PAM250 Molto usata

26 PAM500

27 Matrici di sostituzione Le matrici PAM ricavano ipotesi sulle mutazioni in sequenze lontane a partire dalle mutazioni osservate in sequenze molto simili. Ipotesi molto stretta. BLOSUMx: Famiglia di matrici ricavate direttamente da allineamenti di sequenze con identità maggiore al x%. Per sequenze molto relate vanno usate PAM basse o BLOSUM alte. Per sequenze lontane, viceversa.

28 BLOSUM62 Molto usata

29 BLOSUM90

30 BLOSUM30

31 Distanza tra sequenze Quali eventi consideriamo? Mutazione Delezione e Inserzione Alcuni amminoacidi possono essere stati deleti o inseriti nel corso dellevoluzione A: ALASVLIRLIT--YP B: ASAVHL---ITRLYP Il punteggio (negativo) di un gap dipende solo dal numero di posizioni (n) = -nd lineare (n) = -d - (n-1)eaffine (d: apertura, e: estensione) N.B. Tutti i punteggi sono indipendenti dalla posizione lungo la sequenza

32 Allineamento tra sequenze Date due sequenze, qual è lallineamento a punteggio massimo? Soluzione naïf: provare tutti gli allineamenti possibili e scegliere quello a punteggio maggiore! Per ogni allineamento, possiamo infatti calcolare il punteggio tramite la formula

33 Quanti sono i possibili allineamenti di due sequenze? Scrivere TUTTI i possibili allineamenti senza gap interni delle sequenze: A: tca B: ga Scrivere TUTTI i possibili allineamenti con gap delle medesime sequenze Scrivere i punteggi di allineamento per ognuno degli allineamenti secondo la seguente matrice con penalità di gap LINEARE (d=2)

34 Quanti sono i possibili allineamenti di due sequenze? Caso senza Gap interni --tca -tca tca tca tca- tca-- ga--- ga-- ga- -ga --ga ---ga Date due sequenze di lunghezza m e n, il numero dei possibili scorrimenti differenti è m +n Uguale al primo

35 Caso con gap interni --tca -tca -tca -tca t-ca ga--- ga-- g-a- g--a ga-- gatca gtaca gtcaa gtcaa tgaca tca tca tc-a tca tca- ga- g-a -ga- -ga --ga tgcaa tgcaa tcgaa tcgaa tcaga Quanti sono i possibili allineamenti di due sequenze? I possibili allineamenti sono uguali ai possibili modi di intercalare le due sequenze, mantenendo lordine Date due sequenze di lunghezze n e m, i possibili allineamenti sono (m+n)!/n!m! Per n=m=80ho possibili allineamenti !!!!!!!

36 Il calcolo per intero di tutti gli allineamenti è sovrabbondante ALSKLASPALSAKDLDSPALS ALSKIADSLAPIKDLSPASLT ALSKLASPALSAKDLDSPAL-S ALSKIADSLAPIKDLSPASLT- Algoritmi di programmazione dinamica: idea base I due allineamenti sono per la maggior parte uguali. Lo score è additivo lungo lallineamento. Col metodo naïf la prima parte dellallineamento viene ricalcolata! Si possono memorizzare i punteggi degli allineamenti parziali

37 Costruire lallineamento per passi Date le due sequenze ALSKLASPALSAKDLDSPALS, ALSKIADSLAPIKDLSPASLT il miglior allineamento tra le sottostringhe ALSKLASPA ALSKIAD deriva dai migliori allineamenti ALSKLASP A ALSKLASP A ALSKLASPA - ALSKIA DALSKIAD - ALSKIA D Ed è il migliore dei tre! (additività dei punteggi sulle posizioni) Algoritmi di programmazione dinamica: idea base +++

38 Algoritmo di Needleman e Wunsch Allineamento globale di sequenze, gap a penalità lineare Date due sequenze A e B, di lunghezze a e b, definiamo la matrice F(i,j): punteggio del miglior allineamento tra le sottosequenze: A 1 A 2 A 3 …….A i e B 1 B 2 B 3 …….B j. InizializzazioneF(0,0) = 0 F(i-1,j-1) + s(A i,B j ) Iterazione F(i,j) = Max F(i-1,j) - d F(i,j-1) - d ALSKLASP A ALSKLASP A ALSKLASPA - ALSKIA DALSKIAD - ALSKIA D F(i-1,j-1)F(i-1,j) F(i,j-1) Iterazione F(a,b) è il punteggio del miglior allineamento +++

39 Algoritmo di Needleman e Wunsch Allineare le sequenze ACTGG e ACCA

40 Algoritmo di Needleman e Wunsch d = 2

41 Algoritmo di Needleman e Wunsch d = MAX

42 Algoritmo di Needleman e Wunsch d = 2

43 Algoritmo di Needleman e Wunsch 0 A C T G G 0 A C C A - 0 A C T G G 0 A C C - A Gap in sequenza 2 Gap in sequenza 1Match Punteggio del miglior allineamento

44 Complessità computazionale Numero di operazioni necessario per ottenere un risultato seguendo un algoritmo Algoritmo naïf Date due sequenze di lunghezza n dobbiamo calcolare (2n)!/(n !) 2 punteggi di allineamento. Ognuno richiede dalle n alle 2n operazioni. Poiché n ! n n (2 n) 1/2 e -n Complessità O(2 2n n 1/2 ) Algoritmo Needleman-Wunsch Vanno calcolati (n +1) 2 valori della matrice. Ognuno richiede 4 operazioni: Complessità (n 2 )

45 Allineamenti locali Quelli visti fino ad ora sono allineamenti GLOBALI (tutta la sequenza) Se volessimo cercare solo le zone di miglior sovrapposizione (domini comuni, elementi funzionali conservati…)? La strategia è la medesima. Solo si eliminano i punteggi negativi (meglio riiniziare un allineamento che portarlo a punteggi negativi)

46 Algoritmo di Smith e Waterman Allineamento locale di sequenze, gap a penalità lineare Date due sequenze A e B, di lunghezze a e b, definiamo la matrice F(i,j): punteggio del miglior allineamento locale tra le sottosequenze: A 1 A 2 A 3 …….A i e B 1 B 2 B 3 …….B j. InizializzazioneF(0,0) =0 F(i-1,j-1) + s(A i,B j ) Iterazione F(i,j) = Max F(i-1,j) - d F(i,j-1) - d 0 Iterazione Il punteggio F(i,j) massimo sulla matrice dà il miglior allineamento locale

47 Algoritmo di Smith e Waterman d = 2

48 Algoritmo di Smith e Waterman 0 A C T 0 A T T Gap in sequenza 2 Gap in sequenza 1Match

49 Gli allinementi significativi sono qua! Significatività di un allineamento Dato un allineamento (globale o locale) che abbia ottenuto un punteggio S, come valutare se è significativo? Come sono distribuiti i punteggi di allineamenti di sequenze casuali? Con 100,000 allineamenti di sequenze scorrelate e randomizzate: Score Occorrenza

50 Z=(S- )/ s S=Punteggio di allineamento =Media dei punteggi di allineamento su un insieme random s =Deviazione dei punteggi di allineamento su un insieme random Accuratezza dellallineamento Z<3 non significativo 310 significativoZ-score

51 Lo Z-score di questo allineamento locale è 7.5 su 54 residui Lidentità è 25.9%. Le sequenze sono completamente differenti in struttura secondaria Citrate synthase (2cts) vs transthyritin (2paba) Quanto è affidabile lo Z-score?

52 E-value Numero atteso di allineamenti random con punteggio maggiore o uguale a un punteggio dato (s) E reso possibile dal calcoli statistici E=Kmn e - s m, n: lunghezze delle due sequenze K, : Costanti di scaling Il numero di allineamenti random a punteggio maggiore di s cresce col crescere delle lunghezze delle sequenze (o dei data base con cui confrontiamo una sequenza) e cala esponenziamente al crecere di s

53 Accuratezza dellallineamento La significatività dellE-value dipende dalla lunghezza della banca dati considerata. Per un numero di sequenze pari a quello di SwissProt E> non significativo > E > putativamente significativo > E > possibilmente significativo E < altamente significativoE-value

54 Programmi di allineamento a coppie: LALIGN 1BVD.seq 1MWD.seq

55 Allineamento globale: Sequenze simili 1BVD: mioglobina di capodoglio 1MWD: mioglobina di maiale

56 Lallineamento corrisponde allallineamento strutturale?

57

58 Allineamento locale: Sequenze simili

59 Allineamento globale: Sequenze differenti 1BVD.seq 1VHB.seq 1BVD: mioglobina di capodoglio 1VHB: emoglobina batterica

60 Lallineamento corrisponde allallineamento strutturale?

61

62 Allineamento locale: Sequenze differenti

63 Allineamenti Multipli Il confronto di più sequenze omologhe, può mettere in luce caratteristiche che non emergono da un allineamento a coppie. Allineare molte sequenze Date M sequenze A i, si può definire come allineamento multiplo (globale) ottimo quello che massimizza lo score S= i

64 Allineamenti Multipli Progressivi Allineamento a coppie e raggruppamento A B C D A C B D Allineamento esatto delle sequenze più simili secondo lalbero Allineamento progressivo dei profili derivati dagli allineamenti effettuati

65 CLUSTALW

66 Allineamento di un insieme di mioglobine (più lemoglobina) Sequenze di Mioglobina Allineamento con CLUSTALW

67 1BVD VLSEGEWQLVLHVWAKVEAD---VAGHGQDILIRLFKSHPETLEKFDRFKH 48 1VHB MLDQQTINIIKATVPVLKEHG---VTITTTFYKNLFAKHPEVRPLFDMGR- 47 1BVD LKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIP-----IKY 103 1VHB QESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAG---VAAAH 94 1BVD LEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG VHB YPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIADVFIQVEADLYAQAVE 146 Lallineamento multiplo migliora lallineamento tra due sequenze Allineamento estratto dallallineamento multiplo effettuato da CLUSTALW

68 Ricerca di similarità in Banche Dati Data una sequenza, cercare se esistono sequenze simili in una banca dati Di principio si potrebbero fare allineamenti tra la sequenza target e TUTTE le sequenze Le sequenze da allineare sono troppe, e il processo non è fattibile in tempi brevi nemmeno usando lalgoritmo di NW Si utilizzano algoritmi euristici, che non assicurano il raggiungimento dellallineamento ottimo FASTA BLAST

69 FASTA Data una sequenza (Query), viene divisa in parole lunghe k-tup (generalmente k-tup = 2 per proteine, 6 per DNA) ADKLPTLPLRLDPTNMVFGHLRI Parole (indicizzate per posizione): AD, DK, KL, LP, PT, TL, LP, PR, RL, …,…, …. Lo stesso elenco di parole indicizzato è compilato per ogni sequenza (Subject) del data base in cui si cercano sequenze. E molto rapida la ricerca di parole uguali tra Query e Subject. La differenza degli indici determina la diagonale

70 FASTA Query Subject Identificazione delle identità di parole: identità consecutive danno origine a diagonali più lunghe

71 FASTA Query Subject I punteggi delle regioni più lunghe sono valutati con una matrice di score (PAM o BLOSUM)

72 FASTA Query Subject Vengono cercate regioni ad alta similarità su diagonali vicine

73 Query SubjectFASTA Si procede ad un allineamento esatto (Smith-Waterman) su una banda stretta attorno alla diagonale di maggior similarità (solitamente banda larga attorno ai 32 residui)

74 Sequence similarity with FASTA

75 BLAST Data un data base di sequenze, questo viene indicizzato: per ogni tripletta di residui consecutivi si memorizza in quali sequenze e in quali posizioni questa tripletta viene trovata. AAA AAC AAD ACA...

76 BLAST Data una sequenza (Query), viene divisa in parole lunghe W (generalmente W = 3 per proteine) LSHLPTLPLRLDPTNMVFGHLRI LSH, SHL, HLP, LPT, PTL, TLR, …,…, Per ognuna vengono generate le parole affini secondo la BLOSUM62: parole con punteggio > T (T = ) LSH16 ISH14 MSH14 VSH13 LAH13 LTH13 LNH13

77 BLAST Per ognuna delle parole affini vengono recuperate le sequenze del data base che la contengono (secondo lindicizzazione) La corrispondenza viene estesa (senza gap) a destra e a sinistra fino a che lo score rimane superiore a una soglia S

78 Sequence similarity with BLAST (Basic Local Alignment Search Tool)

79

80

81 BLAST

82

83 Allineamento di tutte le sequenze ATTENZIONE: Non è allineamento multiplo ottimale

84 Profilo di sequenza

85 Utilità del profilo di sequenza Il profilo di sequenza dà una descrizione complessiva di tutte le sequenze: evidenzia le zone più conservate o le mutazioni più frequenti posizione per posizione Allineare una sequenza contro un profilo I parametri di un allineamento sono generalmente identici per tutte le posizioni. Allineare contro un profilo pesa differentemente le mutazioni nelle differenti posizioni

86 PSI-BLAST Sequenza Data Base BLAST Profilo delle sequenze rintracciate PSI-BLAST Fino a convergenza

87 (1)PSI-BLAST takes as an input a single protein sequence and compares it to a protein database, using the gapped BLAST program (2)The program constructs a multiple alignment, and then a profile, from any significant local alignments found. The original query sequence serves as a template for the multiple alignment and profile, whose lengths are identical to that of the query. Different numbers of sequences can be aligned in different template positions (3)The profile is compared to the protein database, again seeking local alignments. After a few minor modifications, the BLAST algorithm can be used for this directly. (4)PSI-BLAST estimates the statistical significance of the local alignments found. Because profile substitution scores are constructed to a fixed scale, and gap scores remain independent of position, the statistical theory and parameters for gapped BLAST alignments remain applicable to profile alignments. (5)Finally, PSI-BLAST iterates, by returning to step (2), an arbitrary number of times or until convergence. The design of PSI-BLAST

88

89 Motivi di sequenza Da allineamenti locali e considerazioni strutturali possono essere derivati motivi sequenziali importanti. Espressioni regolari Allineando i seguenti frammenti che coordinano un atomo di Zn C H C I C R I C C H C L C K I C C H C I C S L C D H C L C T I C C H C I D S I C C H C L C K I C [CD]-H-C-[IL]-[CD]-[RKST]-[IL]-C Deriviamo la seguente espressione regolare

90 Possiamo cercare lespressione regolare in diverse proteine..ALCPCHCLCRICPLIY....KFRLCWCLCKICLKDF....GGPLCHCICSLDASDQ....FLPRCHCLCTICPIYL....WERWDHCIDSICLKDE....LPPICHCLCKICFGLK.. [CD]-H-C-[IL]-[CD]-[RKST]-[IL]-C Yes No Yes Ricerca di motivi

91 PROSITE

92 PROSITE

93 Problemi…. Espressioni regolari La risposta dello scan è sempre Sì o No..ALCPCHCLCRICPLIY....è riconosciuto come legante Zn, così come.....WERWDHCIDSICLKDE.. …anche se loccorrenza di due acidi aspartici come leganti non è mai osservata Allineamenti I parametri di sostituzione, di apertura di gap, ecc.. sono indipendenti dalla posizione, anche se in realtà esistono grossi vincoli allinterno di una stessa famiglia


Scaricare ppt "Fisica Computazionale applicata alle Macromolecole Pier Luigi Martelli Università di Bologna 051 2094005 338 3991609 Metodi di allineamento."

Presentazioni simili


Annunci Google