La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Informatica e Bioinformatica – A. A. 2012-2013 1.

Presentazioni simili


Presentazione sul tema: "Informatica e Bioinformatica – A. A. 2012-2013 1."— Transcript della presentazione:

1 Informatica e Bioinformatica – A. A

2 2 Tra i 16 diversi record presenti in PROSITE che contengono il termine ricercato troviamo il dominio PDZ (PS50106)

3 Informatica e Bioinformatica – A. A Nota: gli Hidden Markov Models sono complessi modelli statistici che dallanalisi di sequenze primarie permettono la predizione di domini proteici e strutture proteiche.

4 Informatica e Bioinformatica – A. A Esempio di ricerca in Pfam Ricerca dei domini presenti nella proteina ZASP: sono individuati 6 record Possono essere visualizzati le principali architetture proteiche che possiedono domini PDZ

5 Informatica e Bioinformatica – A. A Possono essere visualizzati anche gli allineamenti dei domini nelle differenti proteine

6 Informatica e Bioinformatica – A. A I browser genomici UCSC genome browser University of California Santa Cruz Lenorme aumento dei dati riguardanti interi genomi, in particolare quelli derivanti dai progetti di sequenziamento di vertebrati, ha richiesto lo sviluppo di veri e propri browser di genomi. Per questo motivo presso la UCSC è stato sviluppato uno dei primi genome browser in grado di fornire una rapida visualizzazione grafica di ogni regione di genoma di qualsivoglia lunghezza assieme ad una grande quantità di informazioni come: geni noti, geni predetti, ESTs (expressed sequence TAGs), mRNA, geni omologhi di altri organismi, ecc. Successivamente i principali siti (NCBI, EBI ecc.) hanno sviluppato piattaforme sempre più complesse, in grado di integrare il maggior numero di informazioni su una certa regione in particolare del genoma umano e di numerosi altri organismi. (http://genome.ucsc.edu/) Definizione di browser: interfaccia utente che permette di la navigazione tra oggetti, ad esempio Mozilla Web Browser.

7 Informatica e Bioinformatica – A. A

8 Informatica e Bioinformatica – A. A Organismo di cui si vuole visualizzare la regione genomica Nota: durante il sequenziamento di un genoma, spesso vengono rilasciate versioni successive specialmente nella fase finale del progetto: possono essere più o meno definitive. Qui si fa riferimento a varie versioni (release) del genoma umano (lultima è del 2009). Gruppo di organismi di interesse group

9 Informatica e Bioinformatica – A. A Pulsanti di spostamento sul genoma Pulsanti per ingrandire o rimpicciolire larea di interesse Posizione attuale sul genoma Permette di saltare sulla posizione digitata sulla finestra di sinistra chr: rappresentazione schematica e posizione

10 Informatica e Bioinformatica – A. A Posizione (bp) Geni con esoni, le barre spesse, e introni, le barre sottili. Traccia dei trascritti Grado di conservazione della sequenza tra organismi diversi

11 Informatica e Bioinformatica – A. A Moltissimi sono i campi a disposizione, essi possono essere visualizzati in modo diverso o nascosti utilizzando le opzioni presenti nella parte inferiore della pagina Ci sono varie possibilità di visualizzazione di ogni informazione sul genome browser. Provate ad esercitazione Tipologia di traccia

12 Informatica e Bioinformatica – A. A UCSC Genome Browser: descrizione del gene scelto ….e molte altre informazioni!!

13 Informatica e Bioinformatica – A. A Purtroppo non esiste un modo univoco per indicare un gene. Anche i geni che abbiamo spesso utilizzato come esempi (telethonin o zasp) possono essere scritti in modi differenti (tcap, LDB3). Questo crea confusione e non facilita la ricerca informatica. The Human Genome Organisation (HUGO) ha istituito un comitato allo scopo di dare un unico nome significativo a tutti i geni umani. Con questo intento è stato costruito il database HGNC (HUGO Gene Nomenclature Committee).

14 Informatica e Bioinformatica – A. A Oltre che esistere differenti nomi per lo stesso gene/proteina, possono esistere o essere adottati anche differenti modi per descrivere le loro funzioni e le loro localizzazioni. A volte è corretto assegnare differenti funzioni ad una molecola biologica (una proteina che svolge più di una funzione): per non generare confusioni è però necessario usare una terminologia univoca per ogni funzione. Per questo motivo è stato fondato il database Gene Ontology: fornisce una definizione precisa del ruolo svolto dalle singole proteine tramite un vocabolario (le ontologie) che consenta di definire in modo corretto e non arbitrario il o i processi biologici cui una proteina partecipa, la/e sue funzioni molecolari e la/e sue localizzazioni cellulare. Nota: i link con la sigla GO rimandano al database della gene ontology

15 Informatica e Bioinformatica – A. A ALLINEAMENTO DI SEQUENZE

16 Informatica e Bioinformatica – A. A DATABASE DI SEQUENZE RICERCA TESTUALE SIMILARITÀ Ricerca dei record che hanno le sequenze più simili ad una sequenza fornita come query. ora ci occuperemo di questa. Ricerca dei record i cui campi soddisfano determinati criteri. già vista nelle precedenti lezioni

17 Informatica e Bioinformatica – A. A Acidi nucleici e proteine sono costituiti da sequenze lineari rispettivamente di nucleotidi e di aminoacidi; entrambi possono essere rappresentati da singole lettere o stringhe di caratteri. CONSIDERAZIONI GENERALI >gi| |ref|NM_ | Homo sapiens colipase, pancreatic (CLPS), mRNA CTGTCTCCCGCCACCCACACCAGCTGTCCCACTCACCATGGAGAAGATCCTGATCCTCCTGCTTGTCGCCCTC TCTGTGGCCTATGCAGCTCCTGGCCCCCGGGGGATCATTATCAACCTGGAGAACGGTGAGCTCTGCATGAA TAGTGCCCAGTGTAAGAGCAATTGCTGCCAGCATTCAAGTGCGCTGGGCCTGGCCCGCTGCACATCCATGG CCAGCGAGAACAGCGAGTGCTCTGTCAAGACGCTCTATGGGATTTACTACAAGTGTCCCTGTGAGCGTGGC CTGACCTGTGAGGGAGACAAGACCATCGTGGGCTCCATCACCAACACCAACTTTGGCATCTGCCATGACGCT GGACGCTCCAAGCAGTGAGACTGCCCACCCACTCCCACACCTAGCCCAGAATGCTGTAGGCCACTAGGCGC AGGGGCATCTCTCCCCTGCTCCAGCGCATCTCCCGGGCTGGCCACCTCCTTGACCAGCATATCTGTTTTCTG ATTGCGCTCTTCACAATTAAAGGCCTCCTGCAAACCTT >colipase-protein MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQH SSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVG SITNTNFG ICHDAGRSKQ La stringa di caratteri è soltanto una rappresentazione semplificata del corrispondente acido nucleico o proteina, ma permette di gestire ed analizzare le sequenze mediante opportuni programmi informatici. Un acido nucleico rappresentato come stringa di caratteri, formato FASTA. La corrispondente proteina rappresentata come stringa di caratteri, formato FASTA.

18 Informatica e Bioinformatica – A. A Ricerca di similarità tra sequenze Quando viene ottenuta una sequenza nucleotidica o proteica si cerca innanzitutto di individuarne la funzione. Come? Viene subito in mente di cercare tra le sequenze già esistenti in database, alla ricerca di una o più sequenze che siano confrontabili alla nostra. Da questa ricerca cosa possiamo ottenere? Nel caso più semplice, potremmo trovare una sequenza identica alla nostra, magari a funzione già nota. Potremo quasi sicuramente trasferire la funzione della sequenza target (subject) anche alla nostra sequenza query. Potrebbe non esserci alcuna sequenza identica alla nostra. Dovremo in questo caso cercare le sequenze più simili alla nostra: in questo caso potremo formulare delle ipotesi sullipotetica funzione della nostra sequenza query. Più alto sarà il livello di similarità tra le sequenze, più attendibili saranno le nostre ipotesi. Database di sequenze Sequenza query Confronti Lallineamento di sequenze basato sulla similarità è un metodo che ci permette di assegnare una probabile funzione a sequenze prima sconosciute.

19 Informatica e Bioinformatica – A. A Se le sequenze di due proteine o di DNA sono molto simili, allora lo saranno anche le loro strutture e le funzioni. Non è però vero il contrario. Infatti, proteine con funzione e struttura simili non hanno necessariamente sequenze simili (ad esempio i trasportatori di membrana). Ci possono essere proteine con la stessa funzione, ma con struttura e soprattutto sequenza nucleotidica corrispondente diversa. Es. mutazioni silenti che interessano la terza base di un codone.: laminoacido rimane lo stesso ma è cambiato il DNA! Quando inferire la funzione! SEQUENZA SIMILE STRUTTURA SIMILE FUNZIONE SIMILE

20 Informatica e Bioinformatica – A. A Allineamento delle sequenze Analisi comparata delle similarità Un aspetto importante della biologia è capire come si siano originate le strutture biologiche nel corso dell'evoluzione: evoluzione biologica e filogenesi. Analisi comparata classica: confrontando l'anatomia dei vertebrati, si può dedurre che i mammiferi sono nati da un gruppo di rettili nati a loro volta da un gruppo di anfibi nati a loro volta da un gruppo di pesci. Analisi comparata a livello molecolare: confrontando sequenze proteiche in organismi diversi è possibile ricostruire passo dopo passo l'evoluzione delle proteine nel corso della filogenesi e capire come esse abbiano affinato le loro funzioni; oppure come siano nate funzioni nuove da proteine ancestrali con funzioni diverse. lallineamento di sequenze è oggi alla base di molti studi di filogenesi molecolare. Set di geni/proteine Organismo A Set di geni/proteine Organismo B Set di geni/proteine Organismo C Set di geni/proteine Organismo D Set di geni/proteine Organismo E Costruzione dellalbero filogenetico degli organismi A C E B D Analisi comparata

21 Informatica e Bioinformatica – A. A Alcune definizioni: Similarità, omologia ed analogia Spesso si fa confusione tra similarità ed omologia. La similarità è un aspetto quantitativo che indica un livello di somiglianza tra le sequenze: prevede che venga fissato un criterio comparativo ( % identità, % mutazioni conservative ecc.). Lomologia è un aspetto qualitativo che riguarda più propriamente la funzione delle sequenze ed indica unorigine filogenetica comune. L'omologia presuppone l'esistenza di un organismo ancestrale comune da cui le strutture omologhe si sono evolute. Ad esempio l'ala di un uccello e la pinna anteriore di una foca sono omologhi perché si suppone che si siano entrambi evoluti dall'arto anteriore di un rettile ancestrale. Invece, il termine analogia indica che due strutture hanno una funzione simile, ma che si sono evolute indipendentemente. Ad esempio l'ala di un uccello e quella di una farfalla. In questo caso la similarità è determinata da una convergenza adattativa anziché dalla stessa origine evolutiva.

22 Informatica e Bioinformatica – A. A Il termine omologia si applica anche a sequenze di acidi nucleici e proteine: due geni sono omologhi se hanno un gene ancestrale da cui sono originati entrambi. La similarità tra due sequenze è generalmente dovuta ad una origine evolutiva comune per cui molto spesso i termini "similarità" e "omologia" si confondono. Quando non si è certi di unorigine evolutiva comune si dovrebbe parlare di similarità. Un errore ancora più grave è di parlare di percentuale di omologia, che non ha nessun senso.

23 Informatica e Bioinformatica – A. A speciazione: origine di una nuova specie da una già esistente Evoluzione genica ed omologia (A) Quando due geni omologhi derivano dalla speciazione si parla di geni ortologhi. (B) Quando due geni omologhi derivano dalla duplicazione genica, si parla di geni paraloghi. Deve essere chiaro che sia i geni paraloghi che i geni ortologhi sono omologhi perchè il termine omologia si riferisce allesistenza di un comune ancestor.

24 Informatica e Bioinformatica – A. A Vertebrati Pesci con alfa e beta globine Pesci con un solo gene per la globina Pesci con alfa e beta globine Anfibi Rettili Anfibi RettiliMammiferi Globina di uomo ESEMPIO Nel corso dell'evoluzione dei vertebrati (prima della evoluzione degli anfibi), si è verificato un evento di duplicazione del gene della globina (globina alfa e beta). Oggi alcuni pesci hanno un singolo gene, mentre altri ne hanno due: uno simile alla globina alfa e uno alla globina beta. Dai pesci con due globine si sono evoluti gli anfibi, e da questi rettili, uccelli e mammiferi. Tutti i geni della globina sono omologhi in quanto derivano da un unico gene ancestrale: - i geni delle globine alfa sono ortologhi tra loro così come i geni delle globine beta; - i geni dellalfa e beta globina sono paraloghi tra loro in quanto derivano da un processo di duplicazione genica.

25 Informatica e Bioinformatica – A. A Cominciamo ad allineare tra loro le sequenze: la DOT MATRIX Il primo semplice sistema di visualizzazione di allineamenti risale al 1970 e si chiama metodo della Dot Matrix (matrice a punti). Le due sequenze da confrontare sono inserite ai margini di una matrice. Se le due lettere corrispondenti ad una casella sono uguali, allora la casella viene colorata di nero ed apparirà come un punto (dot) allinterno della matrice. Gli allineamenti di una certa lunghezza appariranno come segmenti diagonali e saranno distinguibili visivamente. Ad esempio, il programma DotLet si basa sul metodo della Dot Matrix.

26 Informatica e Bioinformatica – A. A Confrontando due sequenze identiche (la stessa sequenza sia in orizzontale che verticale) otterremo una diagonale continua che parte dall'angolo in alto a sinistra per arrivare a quello in basso a destra. Analisi della matrice NOTA: statisticamente parlando, dal confronto tra sequenze proteiche ci possiamo aspettare una casella positiva ogni 20. Ancor di più, dal confronto di sequenze di acidi nucleici potremmo avere una casella positiva ogni 4: si crea un notevole rumore di fondo. Un modo per ridurre il rumore di fondo è di considerare la media dei valori presenti sulla diagonale allinterno di una determinata finestra (window) invece che considerare le singole caselle della matrice. Variazione del rumore di fondo con diversi valori del parametro window.

27 Informatica e Bioinformatica – A. A Significato della diagonale posta in prossimità dell'angolo in alto a destra: la parte finale della sequenza orizzontale è simile alla parte iniziale della sequenza verticale. In altre parole, la sequenza verticale è simile alla sequenza orizzontale in due porzioni distinte, possibilmente generate da parziale duplicazione del gene. Osservazioni Una diagonale parallela quella principale indica una parziale duplicazione genica o la presenza di domini multipli.

28 Informatica e Bioinformatica – A. A La diagonale principale della figura mostra un'evidente interruzione nella parte centrale per poi continuare su una diagonale diversa, un po' più bassa. Questi salti di diagonale sono dovuti ad alcuni segmenti di sequenza che sono presenti in una sequenza, ma non nell'altra. In altre parole, una sequenza possiede un gap (discontinuità, buco) rispetto allaltra. Nel caso del nostro esempio abbiamo un gap (delezione) nella sequenza orizzontale o, se si preferisce, un segmento di sequenza aggiuntivo (inserzione) nella sequenza verticale. Esempio di gap tra due sequenze

29 Informatica e Bioinformatica – A. A Schema per linterpretazione della Dot Matrix

30 Informatica e Bioinformatica – A. A Con l'approccio della dot matrix viene semplicemente mostrata una matrice, la quale viene in seguito interpretata visivamente ed in modo soggettivo. Abbiamo bisogno di un sistema che sia anche in grado di estrarre i dati dalla matrice e trovare automaticamente gli allineamenti migliori, cioè di identificare il "percorso" migliore all'interno della matrice. Occorre individuare un metodo per confrontare sequenze che utilizzi un criterio per quantificare il grado di similarità tra sequenze. servono dei programmi informatici capaci di applicare appositi algoritmi di allineamento (metodo di allineamento) e che sfruttino un criterio di similarità capace di stimare la bontà di un certo allineamento.

31 Informatica e Bioinformatica – A. A Per determinare la similarità tra due sequenze dobbiamo definire: 1. lalgoritmo di allineamento 2. il criterio di similarità RICERCA DELLE SIMILARITÀ TRA 2 SEQUENZE 1. ALGORITMO DI ALLINEAMENTO Un algoritmo è caratterizzato da - linsieme di tutte le operazioni da eseguire per risolvere un problema (determinazione di tutti i possibili allineamenti) e dalla - complessità, cioè da come varia il numero delle operazioni da effettuare al variare della dimensione del problema: il tempo di esecuzione del programma che implementa lalgoritmo è infatti proporzionale alla complessità dellalgoritmo! Esempio: algoritmo di scorrimento. Si fa scorrere una sequenza sullaltra contando le identità tra le due sequenze 4 identità

32 Informatica e Bioinformatica – A. A CRITERIO DI SIMILARITÀ Funzione di score: Lallineamento delle sequenze dovrebbe essere caratterizzato da un punteggio (score), col quale è possibile valutare (secondo i criteri impostati) il grado di similarità. Ad esempio, con lalgoritmo di scorrimento e una semplice funzione di score che assegni 1 se le lettere tra le due sequenze sono uguali; 0 se le lettere sono diverse, per ogni allineamento si ricava uno score dato dalla somma ottenuta da tutti gli appaiamenti. Il miglior allineamento potrebbe essere quello che ha ottenuto il maggior punteggio. Questo esempio di funzione di score però non rappresenta un criterio molto valido: non ha senso penalizzare tutte le differenze (i mismatch) allo stesso modo! in genere nelle proteine la sostituzione tra aminoacidi carichi non comporta grandi cambiamenti strutturali, mentre la sostituzione di aminoacidi aromatici con altri carichi comporta spesso pesanti cambiamenti conformazionali. Per questo sono state introdotte le matrici di sostituzione (vedi prossima slide). Inoltre possono essere adottate particolari penalità (score) per lapertura o lestensione di un gap che si sommano allo score totale. Adozione di criteri differenti funzioni di score differenti score finali differenti

33 Informatica e Bioinformatica – A. A LE MATRICI DI SOSTITUZIONE Nel caso dellallineamento di aminoacidi è opportuno applicare dei criteri di similarità che non si limitino a verificare lidentità assoluta, ma tengano conto del fatto che gli aminoacidi possono essere più o meno simili tra loro: aminoacidi molto simili possono essere indifferentemente sostituiti in una proteina senza una variazione apprezzabile nella struttura (e quindi funzione) della proteina. Per esempio acido aspartico (D) e acido glutammico (E) sono molto simili e nel corso dellevoluzione prendono facilmente il posto luno dellaltro nelle proteine. Viceversa acido aspartico (D) e triptofano (W) sono molto diversi e non sono interscambiabili. E ragionevole valutare differentemente la sostituzione di D con E e di D con W. Questa tipologia di confronti viene descritta in matrici quadrate di 20x20 caselle in cui si attribuisce un punteggio ad ogni possibile coppia di aminoacidi: - più alto è il punteggio tanto più interscambiabili sono gli aminoacidi; - punteggi negativi penalizzano invece aminoacidi molto differenti. Approfondiamo brevemente le matrici di sostituzione più diffuse, le matrici PAM e le matrici BLOSUM.

34 Informatica e Bioinformatica – A. A Sono basate su uno studio di filogenesi molecolare condotto su 71 famiglie di proteine nel 1978 da Margareth Dayhoff e collaboratori. E stata effettuata una ricostruzione dellevoluzione molecolare delle proteine, in cui ad ogni passaggio evolutivo si presuppone una sostituzione aminoacidica. MATRICI PAM ( point accepted mutation) Le matrici PAM (mutazioni puntiformi accettate) elencano la probabilità di cambiamento da un aminoacido ad un altro in sequenze proteiche omologhe nel corso dellevoluzione. PAM1 rappresenta un singolo passaggio evolutivo (il primo) che tiene conto della probabilità di sostituzione di ogni aminoacido con ciascun altro e tale da prevedere una mutazione ogni 100 aminoacidi.

35 Informatica e Bioinformatica – A. A I passi evolutivi successivi vengono simulati applicando nuovamente le probabilità di sostituzione definite in PAM 1 per ricalcolare, ad ogni nuovo passo, nuove probabilità di sostituzione. Una distanza evolutiva di 100 PAM non corrisponde alla sostituzione del 100% degli aminoacidi, ma a 100 passi evolutivi. Possiamo simulare qualsivoglia distanza evolutiva e calcolarne la corrispondente PAM. Alla fine della simulazione otteniamo dei punteggi che ci indicano quanto più probabile è che lappaiamento tra gli aminoacidi sia dovuto ad omologia piuttosto che al caso. Nota: il modello prevede che le sostituzioni aminoacidiche osservate a grandi distanze evolutive derivino esclusivamente dalla somma di tante mutazioni indipendenti.

36 Informatica e Bioinformatica – A. A MATRICI BLOSUM (1992, Henikoff and Henikoff) Sono basate sulla banca dati BLOCKS, la quale contiene una collezione di allineamenti multipli di segmenti proteici (senza gap). I blocchi sono derivati da osservazione diretta, cioè non viene fatta nessun tipo di assunzione di omologia. Ogni blocco di allineamenti contiene sequenze con un numero di aminoacidi identici superiore ad una certa percentuale (P). Ad esempio, una BLOSUM60 corrisponde ad un 60 % di identità minima (più alto è lindice, tanto più ci si avvicina alla matrice di identità). Da ognuno di questi blocchi è possibile (reiterando il calcolo in modalità simili al metodo PAM) ricavare la frequenza relativa di sostituzione degli aminoacidi e costruire delle matrici di sostituzione.

37 Informatica e Bioinformatica – A. A Le tabelle (o matrici) di sostituzione dei 20 aminoacidi comprendono: 190 valori di relazione tra aminoacidi diversi, più 20 valori di identità, per un totale di 210 valori. Spesso queste matrici sono riportate anche nella loro parte speculare per un totale di altri 190 valori, uguali ai primi. Il tutto si può facilmente rappresentare con una matrice di 20x20, 400 valori. Questa tabella corrisponde alla matrice PAM240, che è una delle più comunemente usate per l'allineamento di sequenze di aminoacidi. In genere, per ogni coppia: valori alti aa. identici; medi aa. simili; bassi aa. molto differenti (ad esempio W & G = -7).

38 Informatica e Bioinformatica – A. A Matrici PAM: si basano sulla frequenza con cui ciascun aminoacido può subire un evento di sostituzione calcolato mediante uno studio di filogenesi molecolare (esistono matrici PAM1, PAM10, ecc. che si differenziano per i passi evolutivi considerati nel loro calcolo) Matrici BLOSUM: sono invece basate su una banca dati (BLOCKS) di allineamenti multipli di segmenti proteici senza gap. (anche in questo caso esistono differenti matrici BLOSUM adatte per allineamenti tra sequenze con differenti distanze filogenetica) Esistono diverse matrici PAM e BLOSUM, che servono per confrontare sequenze simili oppure molto divergenti. Questo perché si basano sulle frequenze di sostituzione osservate in famiglie di proteine simili, che variano in base alla distanza evolutiva delle stesse famiglie di proteine. PAM80 PAM120 PAM200 PAM250: aumento distanza evolutiva. BLOSUM80 BLOSUM62 BLOSUM45: aumento distanza evolutiva. In sintesi Perché le BLOSUM vanno allopposto?

39 Informatica e Bioinformatica – A. A Esistono altre matrici di sostituzione basate su differenti criteri di similarità chimica, oppure sul numero minimo di mutazioni necessarie per sostituire il codone di un aminoacido in un altro. Esistono matrici di sostituzione anche per le sequenze di DNA. Queste matrici contengono informazioni sull'occorrenza di transizioni (purina a purina, pirimidina a pirimidina) e transversioni (purina a pirimidina, e viceversa). I principali programmi di allineamento tra sequenze usano le matrici PAM e BLOSUM per assegnare i punteggi di allineamento (funzione di score).


Scaricare ppt "Informatica e Bioinformatica – A. A. 2012-2013 1."

Presentazioni simili


Annunci Google