La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Biotecnologie, Bioinformatica e Produzione di Idrogeno

Presentazioni simili


Presentazione sul tema: "Biotecnologie, Bioinformatica e Produzione di Idrogeno"— Transcript della presentazione:

1 Biotecnologie, Bioinformatica e Produzione di Idrogeno
Rita Casadio Gruppo di Biocomputing Centro Interdipartimentale per la Ricerca Biotecnologica/Dipartmento di Biologia Università di Bologna

2 Fonti di Energia Rinnovabile:
(Fonti di energia che non dipendono da combustibili le cui riserve sono limitate) energia idroelettrica energia da biomassa (che non esclude il pericolo dell’effetto serra) energia solare energia da maree energia dalle onde energia eolica energia da biomassa L’idrogeno

3 Perche’ l’Idrogeno? È l’elemento più semplice
È l’elemento più abbondante nell’universo È una fonte di energia “pulita” Durante la combustione libera grandi quantita’ di energia per unità di peso (circa 36 kWh per kg) Può essere prodotto in modi diversi utilizzando una varietà di risorse: carbone, petrolio, gas naturale, biomassa e acqua È altamente infiammabile

4 L’energia “pulita”: una cella a Idrogeno
Prodotti di combustione H2 O2

5 ? Vellone et al, Giugno 2005 La Piattaforma Tecnologica Europea per Idrogeno e Celle a Combustibile: il primo esempio di struttura programmatica

6 Stazione di servizio all‘Idrogeno
21 settembre 2004: è stata inaugurato la prima stazione di servizio all'idrogeno in Italia. E' prevista la sua collocazione definitiva in un area che è quella antistante l'impianto dell'AEM (Milano)

7 Biotecnologie Metodi utilizzati nel mondo per produrre idrogeno
La sfida per il 30 millennio: abbassare i costi di produzione Greggio Carbone Gas naturale Reformin Reforming Legno Rifiuti organici Biomassa Nucleare Centrale elettrica Solare Idrogeno Eolica Idroelettrica Geotermale Generatore Elettrolisi H2 Biotecnologie

8 Negli USA il 40% della energia rinnovabile si ricava dalla Biomassa (circa 1012 KWh nel 2004)
Piattaforma Termochimica Pirolisi Gasificazione Prodotti Combustibili, Chimici, Materiali, Calore e Potenza Piattaforma dello zucchero Idrolisi enzimatica Prodotti della lignina Biomassa Raccolta del residuo Coltivazioni a fini energetici Bioraffinerie Intermedi Gas e Liquidi Intermedi Zucchero e Lignina

9 Problemi aperti: Efficienza del processo La produzione di Idrogeno dalla biomassa libera CO2

10 La sfida delle Biotecnologie: rendere le piante ed i batteri capaci di produrre idrogeno in modo efficiente e controllato Come?

11 Composti organici o inorganici
I batteri fotosintetici possono produrre idrogeno sia al buio che alla luce in determinate condizioni e utlizzando substrati diversi…. H2 Composti organici o inorganici Questi processi sono noti da 60 anni! Renderli produttivi su larga scala e’ un problema e comunque i batteri necessitano di substrati Resa max:4mol H2/ mol di glucosio

12 Le alghe possono produrre idrogeno utilizzando solo il sole e l’acqua….
Clamydomonas reinhardtii Il processo ha una resa scarsa: la presenza di ossigeno tende ad inibirlo Allora?

13 Bioinformatica e Nanobiotecnologia:
Conoscendo la struttura degli enzimi e’ possibile riprodurne le funzioni in laboratorio e studiarne l’ingegnerizzazione in altri organismi:

14 The “omic” era Archaea: 23 species Bacteria: 230 species Eukaryotae:
21 species / 255 Chromosomes Update: July 2005

15 The Data Bases of Biological Sequences and Structures
EMBL: 45,236,251 sequences 49,398,852,122 nucleotides NR: 2,664,187 sequences 908,507,914 residues >BGAL_SULSO BETA-GALACTOSIDASE Sulfolobus solfataricus. MYSFPNSFRFGWSQAGFQSEMGTPGSEDPNTDWYKWVHDPENMAAGLVSG DLPENGPGYWGNYKTFHDNAQKMGLKIARLNVEWSRIFPNPLPRPQNFDE SKQDVTEVEINENELKRLDEYANKDALNHYREIFKDLKSRGLYFILNMYH WPLPLWLHDPIRVRRGDFTGPSGWLSTRTVYEFARFSAYIAWKFDDLVDE YSTMNEPNVVGGLGYVGVKSGFPPGYLSFELSRRHMYNIIQAHARAYDGI KSVSKKPVGIIYANSSFQPLTDKDMEAVEMAENDNRWWFFDAIIRGEITR GNEKIVRDDLKGRLDWIGVNYYTRTVVKRTEKGYVSLGGYGHGCERNSVS LAGLPTSDFGWEFFPEGLYDVLTKYWNRYHLYMYVTENGIADDADYQRPY YLVSHVYQVHRAINSGADVRGYLHWSLADNYEWASGFSMRFGLLKVDYNT KRLYWRPSALVYREIATNGAITDEIEHLNSVPPVKPLRH SwissProt: ,882 sequences 67,622,695 residues PDB: ,721 structures membrane proteins 1% Update: July 2005

16 Clostridium pasteurianum Clostridium pasteurianum
Le proteine importanti per la produzione di idrogeno: Idrogenasi e Nitrogenasi 2H+ + 2e H2 Idrogenasi di Clostridium pasteurianum Nitrogenasi di Clostridium pasteurianum Produzione di Idrogeno idrogenasi-dipendente Produzione di Idrogeno nitrogenasi-dipendente

17 Fotosintesi e processo di produzione dell’ Idrogeno in Clostridium pasteurianum
2H+ + 2ferredoxin rid H2 + 2ferredoxin ox Produzione di Idrogeno idrogenasi-dipendente Codice PDB: 1FEH Idrogenasi solo Fe: riduce l’idrogeno Idrogenasi Ni-Fe: ossida l’idrogeno

18 Struttura della Idrogenasi di Clostridium pasteurianum
Peters et al. SCIENCE VOL DECEMBER 1998

19 Fotosintesi e processo di produzione dell’ Idrogeno in Azotobacter vinelandii
L’enzima nitrogenasi catalizza la riduzione di protoni in assenza/presenza di N2 (ad es. atmosfera di Ar), sottoprodotto della fissazione di Azoto Codice PDB: 1N2C Produzione di Idrogeno nitrogenasi-dipendente 2H+ + 2e- ® H2 4ATP     4(ADP+Pi) /

20 Fotosintesi e processo di produzione dell’ Idrogeno nell’alga Chlamydomonas reinhardtii
* 2H+ + 2ferredoxin rid H2 + 2ferredoxin ox Produzione di Idrogeno idrogenasi-dipendente Ricostruzione della struttura 3D a partire dalla sequenza: Modelling Fe-idrogenasi di Chlamydomonas reinhardtii costruita su omologa di Clostridium pasteurianum (http://modbase.compbio.ucsf.edu/modbase-cgi-new/index.cgi; template 1FEH, IdSeq=43%) Idrogenasi solo Fe: riduce l’idrogeno Idrogenasi Ni-Fe: ossida l’idrogeno

21 L’era genomica e le banche dati: 285 organismi sequenziati
Confronto tra genomi

22 identificare altri possibili bio-produttori di idrogeno
Quanti genomi di batteri contengono idrogenasi? La ricerca in banche dati per identificare altri possibili bio-produttori di idrogeno 1: Geobacter sulfurreducens PCA, d-proteobacteria 2: Azotobacter chroococcum, species, g-proteobacteria 3: Rhodococcus opacus, species, high GC Gram+ 4: Methanosarcina mazei, species, euryarchaeotes 5: Cupriavidus necator, species, b-proteobacteria 6: Anabaena sp., species, cyanobacteria 8: Methanococcus voltae, species, euryarchaeotes 9: Methylococcus capsulatus str. Bath, g-proteobacteria 10: Archaeoglobus profundus, species, euryarchaeotes 11: Escherichia coli, species, enterobacteria 12: Carboxydothermus hydrogenoformans, species, eubacteria 13: Aquifex aeolicus, species, aquificales 14: Methanocaldococcus jannaschii, species, euryarchaeotes 15: Synechocystis sp. PCC 6803, species, cyanobacteria 16: Rhodospirillum rubrum, species, a-proteobacteria 17: Desulfomicrobium baculatum, species, d-proteobacteria 18: Methanosarcina barkeri, species, euryarchaeotes 19: Wolinella succinogenes, species, e-proteobacteria 20: Desulfovibrio fructosovorans, species, d-proteobacteria 21: Archaeoglobus fulgidus, species, euryarchaeotes 22: Desulfovibrio vulgaris (strain Miyazaki), d-proteobacteria 23: Rhodobacter capsulatus, species, a-proteobacteria 24: Campylobacter jejuni, species, e-proteobacteria 25: Desulfomicrobium baculatum (strain Norway 4), d-proteobacteria 26: Helicobacter pylori, species, e-proteobacteria 27: Methanothermobacter thermautotrophicus str. Delta H, euryarchaeotes E’ posibile integrare enzimi di batteri in piante o viceversa? E’ possibile costruire un organismo che produca idrogeno in modo controllato?

23 J Craig Venter Science Foundation:
Il ruolo della nanobiotecnologia Trovare il numero minimo di geni necessari per costruire un batterio fotosintetico che produca idrogeno e sia in grado di autodistruggersi al di fuori del laboratorio: la nanofabbrica per l’ idrogeno

24 The Biocomputing Group of the University of Bologna
Remo Piero Gianluca Emidio Ludovica Pier Luigi Paola Ivan Rita Lisa Alberto

25

26 Il centro funzionale della molecola (H-cluster)
Ligando HC1 Formula: C5H4O7S2Fe2 Codice PDB 1FEH Clostridium pasteurianum

27 Nitrogenasi di Azotobacter vinelandii: il ligando HCA-CFM
Hca - 3-hydroxy-3-carboxy-adipic acid Formula: C7H10O7 Cfm - Fe-Mo-S cluster Formula: Fe7MoS9 Codice PDB 1N2C

28 Totale 16 PDB Totale 4 PDB http://scop.berkeley.edu/
Nickel-iron hydrogenase, large/ small subunit [56764]/[56769] Desulfovibrio gigas [56765] (2)     Desulfovibrio vulgaris [56766] (11)     Desulfovibrio fructosovorans [56767] (1)     Desulfomicrobium baculatum [56768] (1)     Desulfovibrio desulfuricans [64509] (1)     Totale 16 PDB Fe-only hydrogenase, catalytic domain [53922] Clostridium pasteurianum [53923] (3)     Desulfovibrio desulfuricans [53925] (1)   Totale 4 PDB


Scaricare ppt "Biotecnologie, Bioinformatica e Produzione di Idrogeno"

Presentazioni simili


Annunci Google