La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Biotecnologie, Bioinformatica e Produzione di Idrogeno Rita Casadio Gruppo di Biocomputing Centro Interdipartimentale per la Ricerca Biotecnologica/Dipartmento.

Presentazioni simili


Presentazione sul tema: "Biotecnologie, Bioinformatica e Produzione di Idrogeno Rita Casadio Gruppo di Biocomputing Centro Interdipartimentale per la Ricerca Biotecnologica/Dipartmento."— Transcript della presentazione:

1 Biotecnologie, Bioinformatica e Produzione di Idrogeno Rita Casadio Gruppo di Biocomputing Centro Interdipartimentale per la Ricerca Biotecnologica/Dipartmento di Biologia Università di Bologna

2 Fonti di Energia Rinnovabile: (Fonti di energia che non dipendono da combustibili le cui riserve sono limitate ) energia idroelettrica energia da biomassa (che non esclude il pericolo delleffetto serra) energia solare energia da maree energia dalle onde energia eolica energia da biomassa Lidrogeno

3 Perche lIdrogeno? È lelemento più semplice È lelemento più abbondante nelluniverso È una fonte di energia pulita Durante la combustione libera grandi quantita di energia per unità di peso (circa 36 kWh per kg) Può essere prodotto in modi diversi utilizzando una varietà di risorse: carbone, petrolio, gas naturale, biomassa e acqua È altamente infiammabile

4 Lenergia pulita: una cella a Idrogeno Prodotti di combustione H2H2 O2O2

5 Vellone et al, Giugno 2005 La Piattaforma Tecnologica Europea per Idrogeno e Celle a Combustibile: il primo esempio di struttura programmatica ?

6 21 settembre 2004: è stata inaugurato la prima stazione di servizio all'idrogeno in Italia. E' prevista la sua collocazione definitiva in un area che è quella antistante l'impianto dell'AEM (Milano) Stazione di servizio allIdrogeno

7 Metodi utilizzati nel mondo per produrre idrogeno La sfida per il 3 0 millennio: abbassare i costi di produzione Greggio Carbone Gas naturale Reformin Reforming Legno Rifiuti organici Biomassa Reforming Nucleare Centrale elettrica Solare Idrogeno Eolica Idroelettrica Geotermale Generatore Elettrolisi Idrogeno H 2 Biotecnologie

8 Negli USA il 40% della energia rinnovabile si ricava dalla Biomassa (circa KWh nel 2004) Piattaforma Termochimica Pirolisi Gasificazione Prodotti Combustibili, Chimici, Materiali, Calore e Potenza Piattaforma dello zucchero Idrolisi enzimatica Prodotti della lignina Biomassa Raccolta del residuo Coltivazioni a fini energetici Bioraffinerie Intermedi Gas e Liquidi Intermedi Zucchero e Lignina

9 Problemi aperti: Efficienza del processo La produzione di Idrogeno dalla biomassa libera CO 2

10 La sfida delle Biotecnologie: rendere le piante ed i batteri capaci di produrre idrogeno in modo efficiente e controllato Come?

11 I batteri fotosintetici possono produrre idrogeno sia al buio che alla luce in determinate condizioni e utlizzando substrati diversi…. H2H2 Composti organici o inorganici Resa max:4mol H 2 / mol di glucosio Questi processi sono noti da 60 anni! Renderli produttivi su larga scala e un problema e comunque i batteri necessitano di substrati

12 Le alghe possono produrre idrogeno utilizzando solo il sole e lacqua…. Clamydomonas reinhardtii Il processo ha una resa scarsa: la presenza di ossigeno tende ad inibirlo Allora?

13 Bioinformatica e Nanobiotecnologia: Conoscendo la struttura degli enzimi e possibile riprodurne le funzioni in laboratorio e studiarne lingegnerizzazione in altri organismi:

14 The omic era Update: July 2005 Archaea: Bacteria: 23 species 230 species 21 species / 255 Chromosomes Eukaryotae:

15 The Data Bases of Biological Sequences and Structures >BGAL_SULSO BETA-GALACTOSIDASE Sulfolobus solfataricus. MYSFPNSFRFGWSQAGFQSEMGTPGSEDPNTDWYKWVHDPENMAAGLVSG DLPENGPGYWGNYKTFHDNAQKMGLKIARLNVEWSRIFPNPLPRPQNFDE SKQDVTEVEINENELKRLDEYANKDALNHYREIFKDLKSRGLYFILNMYH WPLPLWLHDPIRVRRGDFTGPSGWLSTRTVYEFARFSAYIAWKFDDLVDE YSTMNEPNVVGGLGYVGVKSGFPPGYLSFELSRRHMYNIIQAHARAYDGI KSVSKKPVGIIYANSSFQPLTDKDMEAVEMAENDNRWWFFDAIIRGEITR GNEKIVRDDLKGRLDWIGVNYYTRTVVKRTEKGYVSLGGYGHGCERNSVS LAGLPTSDFGWEFFPEGLYDVLTKYWNRYHLYMYVTENGIADDADYQRPY YLVSHVYQVHRAINSGADVRGYLHWSLADNYEWASGFSMRFGLLKVDYNT KRLYWRPSALVYREIATNGAITDEIEHLNSVPPVKPLRH EMBL: 45,236,251 sequences 49,398,852,122 nucleotides SwissProt: 186,882 sequences 67,622,695 residues PDB: 31,721 structures membrane proteins 1% NR: 2,664,187 sequences 908,507,914 residues Update: July 2005

16 Produzione di Idrogeno idrogenasi-dipendente Idrogenasi di Clostridium pasteurianum Nitrogenasi di Clostridium pasteurianum Produzione di Idrogeno nitrogenasi-dipendente 2H + + 2e - H 2 Le proteine importanti per la produzione di idrogeno : Idrogenasi e Nitrogenasi

17 Fotosintesi e processo di produzione dell Idrogeno in Clostridium pasteurianum Codice PDB: 1FEH 2H + + 2ferredoxin rid 6 H 2 + 2ferredoxin ox Produzione di Idrogeno idrogenasi-dipendente Idrogenasi solo Fe: riduce lidrogeno Idrogenasi Ni-Fe: ossida lidrogeno

18 Peters et al. SCIENCE VOL DECEMBER 1998 Struttura della Idrogenasi di Clostridium pasteurianum

19 Produzione di Idrogeno nitrogenasi-dipendente 2H + + 2e - H 2 4ATP 4(ADP+Pi) / Fotosintesi e processo di produzione dell Idrogeno in Azotobacter vinelandii Codice PDB: 1N2C Lenzima nitrogenasi catalizza la riduzione di protoni in assenza/presenza di N 2 (ad es. atmosfera di Ar), sottoprodotto della fissazione di Azoto

20 Fotosintesi e processo di produzione dell Idrogeno nellalga Chlamydomonas reinhardtii 2H + + 2ferredoxin rid 6 H 2 + 2ferredoxin ox Produzione di Idrogeno idrogenasi-dipendente Idrogenasi solo Fe: riduce lidrogeno Idrogenasi Ni-Fe: ossida lidrogeno Ricostruzione della struttura 3D a partire dalla sequenza: Modelling Fe-idrogenasi di Chlamydomonas reinhardtii costruita su omologa di Clostridium pasteurianum (http://modbase.compbio.ucsf.edu/modbase-cgi- new/index.cgi; template 1FEH, IdSeq=43%) *

21 Confronto tra genomi Lera genomica e le banche dati: 285 organismi sequenziati

22 1: Geobacter sulfurreducens PCA, d-proteobacteria 2: Azotobacter chroococcum, species, g-proteobacteria 3: Rhodococcus opacus, species, high GC Gram+ 4: Methanosarcina mazei, species, euryarchaeotes 5: Cupriavidus necator, species, b-proteobacteria 6: Anabaena sp., species, cyanobacteria 8: Methanococcus voltae, species, euryarchaeotes 9: Methylococcus capsulatus str. Bath, g-proteobacteria 10: Archaeoglobus profundus, species, euryarchaeotes 11: Escherichia coli, species, enterobacteria 12: Carboxydothermus hydrogenoformans, species, eubacteria 13: Aquifex aeolicus, species, aquificales 14: Methanocaldococcus jannaschii, species, euryarchaeotes 15: Synechocystis sp. PCC 6803, species, cyanobacteria 16: Rhodospirillum rubrum, species, a-proteobacteria 17: Desulfomicrobium baculatum, species, d-proteobacteria 18: Methanosarcina barkeri, species, euryarchaeotes 19: Wolinella succinogenes, species, e-proteobacteria 20: Desulfovibrio fructosovorans, species, d-proteobacteria 21: Archaeoglobus fulgidus, species, euryarchaeotes 22: Desulfovibrio vulgaris (strain Miyazaki), d-proteobacteria 23: Rhodobacter capsulatus, species, a-proteobacteria 24: Campylobacter jejuni, species, e-proteobacteria 25: Desulfomicrobium baculatum (strain Norway 4), d-proteobacteria 26: Helicobacter pylori, species, e-proteobacteria 27: Methanothermobacter thermautotrophicus str. Delta H, euryarchaeotes Quanti genomi di batteri contengono idrogenasi? La ricerca in banche dati per identificare altri possibili bio-produttori di idrogeno E posibile integrare enzimi di batteri in piante o viceversa? E possibile costruire un organismo che produca idrogeno in modo controllato?

23 J Craig Venter Science Foundation: Il ruolo della nanobiotecnologia Trovare il numero minimo di geni necessari per costruire un batterio fotosintetico che produca idrogeno e sia in grado di autodistruggersi al di fuori del laboratorio: la nanofabbrica per l idrogeno

24 The Biocomputing Group of the University of Bologna Ivan Alberto Ludovica Rita Lisa Pier Luigi Paola Piero Emidio Remo Gianluca

25

26 Ligando HC1 Formula: C 5 H 4 O 7 S 2 Fe 2 Codice PDB 1FEH Clostridium pasteurianum Il centro funzionale della molecola (H-cluster)

27 Hca - 3-hydroxy-3-carboxy-adipic acid Formula: C 7 H 10 O 7 Cfm - Fe-Mo-S cluster Formula: Fe 7 MoS 9 Codice PDB 1N2C Nitrogenasi di Azotobacter vinelandii: il ligando HCA-CFM

28 Nickel-iron hydrogenase, large/ small subunit [56764]/[56769] Desulfovibrio gigas [56765] (2) Desulfovibrio vulgaris [56766] (11) Desulfovibrio fructosovorans [56767] (1) Desulfomicrobium baculatum [56768] (1) Desulfovibrio desulfuricans [64509] (1) Fe-only hydrogenase, catalytic domain [53922] Clostridium pasteurianum [53923] (3) Desulfovibrio desulfuricans [53925] (1) Totale 16 PDB Totale 4 PDB


Scaricare ppt "Biotecnologie, Bioinformatica e Produzione di Idrogeno Rita Casadio Gruppo di Biocomputing Centro Interdipartimentale per la Ricerca Biotecnologica/Dipartmento."

Presentazioni simili


Annunci Google