La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

1) Algoritmi di allineamento 2) Algoritmi di ricerca in database.

Presentazioni simili

Presentazione sul tema: "1) Algoritmi di allineamento 2) Algoritmi di ricerca in database."— Transcript della presentazione:

1 1) Algoritmi di allineamento 2) Algoritmi di ricerca in database

2 similarità allineamento abbiamo visto che per generare e valutare il miglior allineamento di due sequenze di lunghezza m e n, è necessario effettuare m x n confronti il numero di operazioni da effettuare cresce e i tempi di calcolo di conseguenza si allungano se si vogliono considerare anche i possibili gap in tutte le posizioni (e di tutte le lunghezze possibili) di entrambe le sequenze IPLMTRWDQEQESDFGHKLPIYTREWCTRG |||||||||| CHKIPLMTRWDQQESDFGHKLPVIYTREW IPLMTRWDQEQESDFGHKLP-IYTREWCTRG ||||||||| |||||||||| |||||| CHKIPLMTRWDQ-QESDFGHKLPVIYTREW

3 gli allineamenti possono essere visualizzati graficamente in modo rapido (con algoritmi dellordine di mxn) con matrici di punti (dot plots) noi VOGLIAMO considerare i gap, ma non POSSIAMO permetterci algoritmi che considerino tutti i possibili gap in tutte le possibili posizioni identitàfinestra = 5finestra = 15

4 punteggi diversi per ogni possibile coppia di residui allineati (matrici di sostituzione) gap penalties e gap extension penalties per valutare penalizzazioni dovute allintroduzione di gap nelle sequenze allineate abbiamo definito un modo sofisticato di valutare il punteggio di un allineamento, che tenga conto di

5 che algoritmi possiamo usare? PROGRAMMAZIONE DINAMICA razionalizzare il problema: considerare anche i gap pur continuando ad utilizzare un algoritmo dellordine di n 2 )

6 spesso loutput mostra più allineamenti DIVERSI col massimo del punteggio ci mette TROPPO TEMPO per effettuare una ricerca esaustiva

7 scegliere una matrice di sostituzione per valutare gli appaiamenti tra residui definire dei punteggi di penalizzazione per i gaps algoritmi di allineamento che utilizzano una tecnica di programmazione dinamica: Needleman e Wunsch (1970) Smith e Waterman (1981)

8 3 passi successivi 1) consideriamo le due sequenze da allineare in una specie di dot plot : nelle caselle scriviamo i punteggi in rosso derivati dalla matrice di sostituzione scelta


10 QERTY |||: QERS allineamentopunteggio QQ + EE + RR + TS = 4 + 4 + 6 + 1 = 15 cominciamo a calcolare la matrice di questo allineamento usata nellalgoritmo di programmazione dinamica Q E R T Y Q 4 2 1-4 E 2 4 0-4 R 1 6 -4 S 0 0 1-3

11 2)ricerca del percorso che consente di ottenere il massimo punteggio in base a delle regole stabilite, tenendo anche conto dei gaps se una sequenza è scritta da sinistra a destra e laltra dall'alto in basso, allora qualsiasi percorso valido deve mantenere sempre una direzione tendenziale che va dall'angolo in alto a sinistra a quello in basso a destra

12 Misura della similarità: i punteggi in diagonale si SOMMANO fuori dalla diagonale, si PENALIZZA di 5 punti evidenzieremo in grigio il migliore percorso allinterno della matrice, secondo le regole e i punteggi stabiliti


14 globale il migliore allineamento globale per le sequenze in matrice risulta quindi il seguente: TFDERILGVQ-TYWAECLA || | | |. || QTFWECIKGDNATY

15 per ricostruire lallineamento migliore si può memorizzare il percorso disegnato riempiendo la matrice alla fine bisogna partire dalla casella a punteggio maggiore e ricostruire il percorso a ritroso seguendo le freccette TFDERILGVQ-TYWAECLA || | | |. || QTFWECIKGDNATY

16 Qual è il tipo di allineamento che consideriamo più interessante dal punto di vista biologico? date due sequenze, per esempio: 1) LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK 2) TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHKAG


18 a livello di DNA, troviamo regioni con similarità locali che riflettono situazioni interessanti: ad esempio introni/esoni, inserzioni/delezioni, transposoni, regioni promotore… esoniintroni

19 allineamenti globali: confrontare accuratamente due sequenze la cui similarità sia estesa per tutta la lunghezza (es. Proteine omologhe)

20 Usando matrici di sostituzione contenenti esclusivamente valori positivi il valore massimo della matrice si trova sempre nellultima riga o nellultima colonna ne consegue che lallineamento ottenuto è un allineamento globale il numero di operazioni effettuate è proporzionale a m x n abbiamo considerato tutti i possibili allineamenti tra le due sequenze e tutte le possibili posizioni per i gap

21 se le matrici contenessero sia valori positivi che negativi (come le PAM o le BLOSUM), i valori più alti potrebbero trovarsi anche in porzioni INTERNE alla matrice Come ottenere un allineamento locale? ogni percorso che totalizza un punteggio negativo viene azzerato e può venire considerato come linizio di un nuovo allineamento locale quando i tre percorsi di possibile provenienza per una casella risultano negativi, il punteggio associato alla casella sarà pari a zero

22 3-3 9 30 0 12

23 -7-6 0-2 00 1 0


25 Gli algoritmi per il Database similarity searching FASTA BLAST

26 Prerequisiti dei metodi di Database similarity searching Velocità Sensibilità Selettività

27 Fissata una soglia minima di similarità se TP = positivi veri PP = positivi predetti (falsi e veri) AP = actual positives ( n.reale di sequenze omologhe presenti nel db indipendentemente dalla soglia) Prerequisiti dei metodi di Database similarity searching

28 Database similarity searching Sensibilità = TP/AP Selettività =TP/PP La scelta della soglia e fatta su basi statistiche ed e determinante. Alta sensibilità bassa selettività e viceversa

29 Database similarity searching Ambedue i metodi (FASTA e BLAST) effettuano ricerche di similarità mediante applicazioni di metodi per allineamenti locali e, dal confronto di una sequenza anonima con set di sequenze a funzione nota, selezionano le sequenze con punteggi di similarità (scores) superiore ad una certa soglia (threshold), valutata su basi statistiche e dinamicamente in correlazione con il dataset sotto studio.

30 Database searching Ambedue i metodi ottengono una elevata velocità di esecuzione grazie alla trasformazione delle sequenze in vettori Scelta la dimensione w della stringa su cui operare per la ricerca delle similarità, le sequenze da confrontare sono trasformate in vettori di dimensione D w, in ogni cella dei quali sono riportate le posizioni in cui la i- esima "stringa" di dimensione w ricorre nella sequenza

31 Database searching FASTA Ammette i gaps e produce una sola regione di miglior similarità per ogni coppia analizzata (query seq. vs. db seq)

32 Database searching BLAST Non ammette i gaps e produce più regioni di similarità per ogni coppia analizzata

33 FASTA Fissato il parametro ktup ( il numero di residui contigui identici), consideriamo due sequenze, S 1 e S 2, e cerchiamo le k-tuple perfettamente identiche il cui inizio é localizzato rispettivamente nelle posizioni i e j; nell'ipotetica matrice dot-plot relativa a queste due sequenze tale identità sarà localizzata nella diagonale m=i-j.

34 FASTA Vengono individuate le diagonali che presentano la più alta densità di k-tuple identiche. Le k-tuple identiche vengono assegnate alla medesima regione di similarità se sono separate da un numero di residui inferiore ad un valore soglia prestabilito nellalgoritmo (Pearson, 1990). Vengono selezionate le prime dieci regioni di similarità localizzate anche su differenti diagonali.

35 FASTA fase 2 Il punteggio di similarità relativo alle regioni precedentemente considerate viene calcolato prendendo in considerazione tratti di sequenza identici più corti di ktup, eventuali sostituzioni conservative e consentendo anche lintroduzione di piccoli gaps. Per le sequenze proteiche PAM-250 Per le sequenze nucleotidiche punteggio positivo alle identità e negativo alle differenze. Tra tutte le regioni diagonali di similarità quella che totalizza il massimo punteggio di similarità viene definita "regione primaria di similarità" e il punteggio corrispondente é denominato init1

36 FASTA fase 3 Le regioni di similarità precedentemente determinate vengono potenzialmente ricongiunte per formare un unico allineamento. Questa ricongiunzione viene effettuata se la penalità di ricongiungimento, proporzionale alla distanza tra le regioni di similarità, é inferiore al contributo dato al punteggio di similarità dalla regione di similarità che viene ricongiunta nell'allineamento.

37 FASTA fase 3 Il punteggio di similarità relativo all'allineamento che così viene determinato viene denominato punteggio initn e viene usato per ordinare le sequenze della banca dati secondo il grado di similarità decrescente con la sequenza sonda in esame.

38 FASTA fase 4 Nella quarta ed ultima fase, l'allineamento precedentemente ottenuto viene ulteriormente ottimizzato utilizzando la procedura di allineamento descritta da Chao et al. (1992) che utilizza un algoritmo per l'allineamento di due sequenze all'interno di una banda diagonale di dimesioni predeterminate. Il punteggio di similarità calcolato in quest'ultima fase viene denominato punteggio opt.

39 Le coppie di segmenti, presenti nella stessa coppia di sequenze, che totalizzino un punteggio di similarità statisticamente significativo, superiore ad una soglia S, vengono definiti HSP (High scoring Segment Pairs). Nella stessa coppia possono esserci più HSP di cui é anche possibile calcolare la probabilità di occorrenza (Karlin & Altschul, 1993). BLAST (Basic Local Alignment Search Tool)

40 Una volta individuata una stringa coincidente (matching word), questa viene estesa verso entrambe le direzioni. La procedura di estensione viene arrestata in una delle due direzioni quando il punteggio di similarità relativo alla coppia di segmenti in esame viene decrementato, di un certo valore prestabilito, rispetto a quello relativo ad una minore estensione della stessa coppia di segmenti. BLAST (Basic Local Alignment Search Tool)


42 Lidea di fondo : lallineamento ottimale tra due sequenze omologhe, anche se altamente divergenti, ha unalta probabilità di contenere una o più coppie di segmenti caratterizzati da un punteggio di similarità piuttosto elevato e tale da consentire una affidabile distinzione tra sequenze correlate da relazione di omologia e sequenze non correlate. Un algoritmo in grado di individuare in modo estremamente rapido tutte le coppie di segmenti per cui il punteggio di similarità risulta statisticamente significativo. BLAST (Basic Local Alignment Search Tool)

43 La peculiare strategia di BLAST é di cercare esclusivamente coppie di segmenti che contengano una coppia di stringhe di lunghezza w il cui relativo punteggio di similarità sia almeno pari ad una soglia T. Il valore della soglia T (S) viene stimato sulla base della dimensione di w. BLAST (Basic Local Alignment Search Tool)

44 S(a,b) utilizza matrici BLOSUM o PAM per le sequenze aminoacidiche o un punteggio pari a +5 per le identità e -4 per le differenze per sequenze nucleotidiche Si definisce MSP (Maximal scoring Segment Pair) la coppia di segmenti, di eguale lunghezza, che realizza il massimo punteggio di similarità nel confronto di due sequenze; lalgorimo ne valuta in modo rigoroso la significatività statistica (Karlin & Altschul, 1990, 1993).


Scaricare ppt "1) Algoritmi di allineamento 2) Algoritmi di ricerca in database."

Presentazioni simili

Annunci Google