La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Docente: Dr. Stefania Bortoluzzi Dipartimento di Biologia Universita' di Padova viale G. Colombo 3, 35131, Padova Tel. 0039 049 8276214

Presentazioni simili


Presentazione sul tema: "Docente: Dr. Stefania Bortoluzzi Dipartimento di Biologia Universita' di Padova viale G. Colombo 3, 35131, Padova Tel. 0039 049 8276214"— Transcript della presentazione:

1 Docente: Dr. Stefania Bortoluzzi Dipartimento di Biologia Universita' di Padova viale G. Colombo 3, 35131, Padova Tel Corso di Laurea Specialistica in Biologia Sanitaria Universita' di Padova C.I. di Metodi statistici per la Biologia, Informatica e Laboratorio di Informatica (Mod. B) 40 ore

2 PROGRAMMA DEL CORSO 8 ore di lezione + 8 esercitazioni da 4 ore = 40 ore DIDATTICA ORE ARGOMENTO Lezioni 2 Allineamento di sequenze a coppie. Allineamento globale e allineamento locale. Ricerca di similarita': BLAST. Lezioni 2 Accesso a sequenze genomiche complete ed annotate: Genome Browser. Allineamento di sequenze trascritte con sequenze genomiche: BLAT. Lezioni 2 Dati d'espressione genica: ESTs, SAGE e microarray. NCBI GEO. Lezioni2 Pattern matching e pattern discovery per lo studio di sequenze promotoriali Esercitazioni4 x 8 volte

3 I LEZIONE Allineamento di sequenze Allineamento globale e allineamento locale Allineamento di sequenze a coppie o multiplo Ricerca di similarita’ BLAST

4 RICERCA DI SIMILARITÀ SIMILARITA’  ?  OMOLOGIA OMOLOGIA proprieta’ di caratteri (sequenze) dovuta alla loro derivazione dallo stesso antenato comune SIMILARITA’ “grado” di somiglianza tra 2 sequenze La similarita’ osservata tra due sequenze PUO’ indicare che esse siano omologhe, cioe’ evolutivamente correlate La similarita’ e’ una proprieta’ quantitativa, si puo’ misurare L’omologia e’ una proprieta’ qualitativa La similarita’ tra sequenze si osserva, l’omologia tra sequenze si puo’ ipotizzare in base alla similarita’ osservata.

5 OMOLOGIA E OMOPLASIA Omologia similarita’ dovuta a derivazione dallo stesso antenato comune Omoplasia similarita’ dovuta a convergenza stessa pressione selettiva su due linee evolutive puo’ condurre a caratteri simili ORTOLOGIA E PARALOGIA OMOLOGIA ANTENATO COMUNE ORTOLOGIAPARALOGIA PROCESSO DI SPECIAZIONEDUPLICAZIONE GENICA Descrivo le relazioni tra geni di una famiglia intraorganismo (paralogia) o tra diversi organismi (ortologia )

6

7 ALLINEAMENTO DI SEQUENZE Procedura per comparare due o piu’ sequenze, volta a stabilire un insieme di relazioni biunivoche tra coppie di residui delle sequenze considerate che massimizzino la similarita’ tra le sequenze stesse

8 ALLINEAMENTO DI SEQUENZE A COPPIE AGTTTGAATGTTTTGTGTGAAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTC ||||||||||||||||||| |||||||| ||| | |||||| ||||||||||||||||| AGTTTGAATGTTTTGTGTGTGAGGAGTATTCCAAGGGATGAGTTGACCACCAATCATTTC MULTIPLO KFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTl KYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKT- KFKHHLKEHVRIHSGEKPFGCDNCGKRFSHSGSFSSHMTSKKCISMGLKLNNNRALLKRl KFKHHLKEHIRIHSGEKPFECQQCHKRFSHSGSYSSHMSSKKCV KYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNGRPRTGLKTs

9 Allineamento GLOBALE o LOCALE GLOBALEconsidera la similarita’ tra due sequenze in tutta la loro lunghezza LOCALE considera solo specifiche REGIONI simili tra alcune parti delle sequenze in analisi Global alignment LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||. | | |.|.| || || | || TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHKAG Local alignment LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||||||||.|||| TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHK

10 Esistono molti metodi per allineare sequenze, basati su algoritmi ESATTI (es. Smith e Waterman) EURISTICI, molto veloci e molto diffusi (FASTA e BLAST) I programmi per l’allineamento di sequenze a coppie si basano sui seguenti metodi: Matrice Dot Plot Algoritmi di programmazione dinamica Metodi “delle parole” o “k-tuples”, come FASTA e BLAST

11 AACCGAAGGACTTTAATC AAGGCCTAACCCCTTTGTCC AA..CCGAAGGACTTTAATC AACCGAAGGACT TTAATC || |..||...||||...| | |||.|| ||..|| AAGGCTAAACCCCTTTGTCC A AGGCCTAACCCCTTTGTC Fattibile solo per poche sequenze molto brevi! Possono esistere piu’ allineamenti “equivalenti” seq1 AACCGTTGACTTTGACC Seq2ACCGTAGACTAATTAACC AACCGTTGACT..TTGACC | ||||.|||| ||.||| A.CCGTAGACTAATTAACC Allineamento manuale basato sulla massimizzazione del numero residui identici allineati

12 La bonta’ di un allineamento puo’ essere misurata tenendo conto del numero di gaps introdotti e del numero di mismatches rimanenti (edit distance). Esistono tuttavia molte misure diverse, molte metriche, utilizzate per produrre gli allineamenti e misurarne la bonta’. Un metodo molto semplice ed utile per la comparazione di due sequenze e’ quello della MATRICE DOTPLOT A|X X X T| X X G| X T| X X A T C A C T G T A C| X | | | | | | | A|X X X A T C A - - G T A C| X T| X X A|X X X A T C A G T A

13 MISURE DI IDENTITA’ E DI SIMILARITA’ Il modo piu’ semplice per definire le relazioni di similarita’ tra nucleotidi e’ basato solo su IDENTITA’ e DIVERSITA’. La piu’ semplice matrice di similarita’ per i nulceotidi e’ la “UNITARY SCORING MATRIX”, matrice che assegna punteggio 1 acoppie di residui identici e 0 ai mismatches. A C G T A | C | G | T | Possono esserci altri criteri per dare un peso diverso da zero a matches tra residui non identici (ad.es. Pesare in modo diverso transizioni e transversioni)

14 MISURE DI IDENTITA’ E DI SIMILARITA’ E’ possibile misurare la similarita’ tra aminoacidi tenendo conto delle loro proprieta’ chimico-fisiche ad. es. l’ acido glutammico e’ piu’ simile all’acido aspartico che alla fenilalanina Un altro modo per misurare la similarita’ tra aminoacidi e’ fondato sulle frequenze osservate di specifiche sostituzioni aminoacidiche in opportuni gruppi di allineamenti. La similarita’ tra due specifici aminoacidi, diciamo A e G, e’ proporzionale alla frequenza con cui si osserva la sostituzione A->G. Le MATRICI DI SOSTITUZIONE piu’ conosciute ed utilizzate sono le matrici PAM (o Dayhoff Mutation Data (MD) Matrices) e le matrici BLOSUM.

15 MATRICI PAM (Dayhoff et al. 1978) Sono basate sul concetto di mutazione puntiforme accettata, Point Accepted Mutation (PAM). Le prime matrici PAM sono state compilate in base alla’analisi delle sostituzioni osservate in un dataset costituito da diversi gruppi di proteine omologhe, ed in particolare su 1572 sostituzioni osservate in 71 gruppi di sequenze di proteine omologhe con similarita’ molto alta (85% di identita’). La scelta di proteine molto simili era motivata dalla semplicita’ dell’allineamento, senza necessita’ di introdurre correzioni per le multiple hits (sostituzioni come A->G->A or A->G->N). L’analisi degli allineamenti mostro’ come diverse sostituzioni aminoacidiche si presentassero con frequenze anche molto differenti: le sostituzioni che non alterano seriamente la funzione della proteina, quelle “accettate” dalla selezione, si osservano piu’ di frequente di quelle distruttive.

16 MATRICI PAM La frequenza osservata per ciascuna specifica sostituzione (es. A  G) puo’ essere usata per stimare la probabilita’ della transizione corrispondente in un allineamento di proteine omologhe. Le probabilita’ di tutte le possibili sostituzioni sono riportate nella matrice PAM Matrici BLOSUM (Henikoff and Henikoff, 1992) Matrici di sostituzione derivate dall’analisi di oltre 2000 blocchi di allineamenti multipli di sequenze, che riguardavano regioni conservate di sequenze correlate. Per ridurre il contributo di coppie di amminoacidi di proteine altamente correlate, gruppi di sequenze molto simili sono state trattate come se fossero sequenze singole ed e’ stato calcolato il contributo medio di ciascuna posizione. Utilizzando diversi cut-off per il raggruppamento di sequenze simili si sono ottenute diverse matrici BLOSUM. BLOSUM62, BLOSUM80, …

17 BLOSUM 80 A R N D C Q E G H I L K M F P S T W Y V B Z X * A 7 R -3 9 N D C Q E G H I L K M F P S T W Y V B Z X *

18 L’utilizzo della matrice di similarita’ appropriata per ciascuna analisi e’ cruciale per avere buoni risultati. Infatti relazioni importanti da un punto di vista biologico possono essere indicate da una significativita’ statistica anche molto debole. Sequenze poco divergenti     molto divergenti BLOSUM80BLOSUM62BLOSUM45 PAM1 PAM120PAM250

19 ALGORITMI PER L’ALLINEAMENTO DI SEQUENZE Algoritmo di Needleman & Wunsch  allineamento globale Algoritmo di Smith & Waterman  allineamento locale

20 ALGORITMO DI NEEDLEMAN & WUNSCH PER L’ALLINEAMENTO GLOBALE Questo metodo permette di determinare l’allineamento globale ottimale attraverso un’interpretazione computazionale della matrice dotplot. L’idea e’ di calcolare ricorsivamente l’allineamento ottimo per sottosequenze via via piu’ lunghe, cosa possibile in virtu’ dell’indipendenza e dell’additivita’ dei punteggi. Le sequenze vengono comparate attraverso una matrice 2D, le celle rappresentanti matches hanno punteggio 1; 0 per i mismatches. L’algoritmo prevede una serie di somme successive dei punteggi contenuti nelle celle, che da’ luogo ad una matrice di punteggi, la cui analisi permette la costruzione dell’allineamento. Iniziando dalla casella piu’ in basso e piu’ a destra ( M(y,z) ), il valore massimo contenuto nella caselle della riga y e della colonna z viene sommato a quello nelle caselle della linea i=y-1 e della colonna j=z-1. Alla fine delle iterazioni il punteggio della cella piu’ in alto a sinistra rappresenta il punteggio totale dell’allineamento, senza considerare le gap penalties.

21 Needleman-Wunsch Algorithm Three main steps 1. Assign similarity values 2. For each cell, look at all possible pathways back to the beginning of the sequence (allowing insertions and deletions) and give that cell the value of the maximum scoring pathway 3. Construct an alignment (pathway) back from the highest scoring cell to give the highest scoring alignment

22 Needleman-Wunsch Algorithm Similarity values A numerical value is assigned to every cell in the array depending on the similarity/dissimilarity of the two residues These may be simple scores or more complicated, e.g. related to chemical similarities or frequency of observed substitutions The example shown has –match = +1 –mismatch = 0

23 Needleman-Wunsch Algorithm Score pathways through array For each cell want to know the maximum possible score for an alignment ending at that point Searches subrow and subcolumn, as shown, for the highest score Adds this to the score for the current cell Proceeds row by row through the array Gap penalty for the introduction of gaps in the alignment (presumed insertions or deletions into one sequence) … here = 0 H ij =max{H i-1, j-1 +s(a i,b j ), max{H i-k,j-1 -W k +s(a i,b j )}, max{H i-1, j-l -W l +s(a i,b j )}}

24 Needleman-Wunsch Algorithm Construct alignment The alignment score is cumulative by adding along a path through the array The best alignment has the highest score i.e. the maximum match Maximum match = largest number resulting from summing the cell values of every pathway The maximum match will ALWAYS be somewhere in the outer row or column shown The alignment is constructed by working backwards from the maximum match MP-RCLCQR-JNCBA | || | | | | | -PBRCKC-RNJ-CJA

25 Needleman-Wunsch FASE 1 R F C W T Y P D W K F W T P D P Y D A W Identificazione residui identici Needleman-Wunsch FASE 2 R F C W T Y P D W K F W T P D P Y D A W Somme successive

26 Needleman-Wunsch FASE 4 RFCWTYPD----WK -F-WT-PDPYDAW- Deduzione allineamento ottimale Needleman-Wunsch FASE 3 R F C W T Y P D W K F W T P D P Y D A W Tracciare i percorsi massimali

27 CALCOLO DEL PUNTEGGIO PER UN ALLINEAMENTO Data una coppia di sequenze Sa e Sb Per ogni coppia di elementi a i e b j di Sa e Sb si definisce un punteggio s(a i,b j ) s(a i,b j ) =  se a i = b j s(a i,b j ) =  se a i  b j, con  >  Ad ogni ogni gap viene assegnato un punteggio dato da: W k =  +  (k-1) Dove W k e’ una funzione lineare che assegna una penalita’ constante alla presenza del gap ( , ad es. -10) e una penalita’ proporzionale alla lunghezza del gap meno uno.  (gap opening penalty)  (gap extension penalty) Il punteggio complessivo risultera’ da:  (s(a i,b j ) ) +  ( W k ) MATCHES MISMATCHES GAPS

28 ALGORITMO DI SMITH & WATERMAN PER L’ALLINEAMENTO LOCALE Lo scopo degli algoritmi di allineamento locale di due sequenze e’ trovare la regioni piu’ lunga della prima sequenza che produce un allineamento ottimale, dati certi parametri, con una regione della seconda. Per misurare la bonta’ degli allineamenti si definiscono due funzioni: SIMILARITY SCORE, dipende dal PUNTEGGIO PER IL MATCH di residui ad es. 2 match, -1 mismatch (oppure A con A +2, A con G +1, …) GAP PENALTY W=a+b(k-1) ) a = GOP gap opening penalty b = GEP gap extension penalty ES: ATTCCGAG match +2, mismatch –1, GOP -5, GEP -2 | || A----GAC MATCHES 3 x 2 = 6 MISMATCHES 1 x –1 = -1 GAPS 1 lungo 4 nucleotidi -5 + (3 x –2) Anche il metodo di Smith and Waterman utilizza una matrice per comparare le due sequenze, in cui il valore numerico contenuto in ciascuna cella rappresenta il punteggio dell’allineamento locale ha inizio dai due residui corrispondenti. Cosi’, l’identificazione dei punteggi piu’ alti nella matrice permette di trovare i migliori allineamenti locali tra le due sequenze.

29 RICERCA DI SIMILARITÀ Una sequenza “da sola” non e’ informativa, deve essere analizzata comparativamente al contenuto dei database perche’ possano essere formulate delle ipotesi sulla sue relazioni evolutive con sequenze simili o sulla sua funzione. Domande cui si puo’ rispondere con una ricerca di similarita’: Data una sequenza, ci sono cose simili nel database? Ho trovato un nuovo gene o una nuova proteina? Il gene ha somiglianze con qualche altro gene nella stessa specie o in altre specie? Fare ipotesi sulla funzione di una proteina Trovare le regione di sovrapposizione tra sequenze contigue Trovare la regione genomica codificante un trascritto Studiare l’evoluzione di popolazioni o specie

30 RICERCA DI SIMILARITÀ I programmi per la ricerca di similarita’ devono essere: veloci, selettivi e sensibili BLAST e FASTA sono veloci perche’ rappresentano le sequenze contenute nel database attraverso un dizionario. L’occorrenza di ciascuna delle possibili stringhe di sequenza di una data dimensione (D w ) in una sequenza del database viene registrato come un 1. In questo modo ciascuna sequenza del database e’ rappresentata da un vettore di 0 e 1, di dimensione D w, in cui un 1 in una cella rappresenta una posizione in cui la stringa ad essa associata si presenta nella sequenza stessa. BLAST e FASTA si basano entrambi sull’assunzione che un allineamento ottimale tra due sequenze omologhe anche piuttosto divergenti ha elevata probabilita’ di contenere una o piu’ coppie di segmenti con punteggio di similarita’ elevato. L’osservazione di queste coppie rappresenta quindi un buon modo per discriminare tra allineamenti tra sequenze omologhe e allineamenti tra sequenze non correlate.

31 BLAST Basic Local Alignment Search Tool (Altschul 1990) L’ algoritmo di BLAST e’ euristico e opera: 1tagliando le sequenze da comparare in piccoli pezzi (parole) 2Ignorando tutte le coppie di parole (sequenza query/database) la cui comparazione da’ un punteggio inferiore ad un limite fissato 3Cercando di estendere tutte le hits rimanenti sino a che l’allineamento locale raggiunge un certo punteggio Dati una SEQUENZA QUERY ed un DATABASE DI SEQUENZE, BLAST ricerca nel database “parole” di lunghezza almeno “W” con un punteggio di similarita’ di almeno “T” una volta allineate con la sequenza “query” (HSP, High Scoring Pairs). Le “parole” selezionate vengono estese, se possibile, fino a raggiungere un punteggio superiore a “S” oppure un “E-value” inferiore al limite specificato.

32

33 La SIGNIFICATIVITA’ di un allineamento si calcola come P value o E value P value e’ la probabilita’ di ottenere per caso un allineamento con punteggio uguale o migliore di quello osservato Si calcola mettendo in relazione il punteggio osservato (S) con la distribuzione attesa di HSP quando si comparano sequenze random della stessa lunghezza e composizione di quella in analisi (query sequence) Piu’ il Pvalue e’ vicino a 0 piu’ e’ significativo 2x e’ meglio do !!! E value e’ il numero atteso di allineamenti con punteggio uguale o migliore di quello osservato Piu’ e’ basso piu’ e’ buono

34

35 Usare BLAST OPZIONI Sequenza querynucleotidica proteica (sequenza in formato FASTA, GenBank Accession numbers o GI numbers) Databasedatabase di seq. nucleotidiche database di seq. proteiche ProgrammaStandard BLAST (blastn) Standard protein BLAST (blastp) translated blast (blastx, tblastn, tblastx) MEGABLAST PSI-BLAST PHI-BLAST + altre opzioni … Blast selection table

36 Usare BLAST database di seq. nucleotidiche nr All GenBank+EMBL+DDBJ+PDB sequences (but no EST, STS, GSS, or phase 0, 1 or 2 HTGS sequences). No longer "non-redundant". est Database of GenBank+EMBL+DDBJ sequences from EST division. est_human est_mouse htgs Unfinished High Throughput Genomic Sequences yeast Saccharomyces cerevisiae genomic nucleotide sequences mito Database of mitochondrial sequences vector Vector subset of GenBank(R), NCBI, in month All new or revised GenBank+EMBL+DDBJ+PDB sequences alu Select Alu repeats from REPBASE, suitable for masking Alu repeats from query sequences. dbsts Database of GenBank+EMBL+DDBJ sequences from STS division. chromosome Searches Complete Genomes, Complete Chromosome, or contigs form the NCBI Reference Sequence project.

37 Usare BLAST PROGRAMMI Blastn Nucleotide query - Nucleotide db Blastp Protein query - Protein db Translating BLAST attraverso la traduzione concettuale della query sequence o dei database permette di comparare una sequenza nucleotidica con database di proteine o viceversa. Translated query - Protein db: blastx Protein query - Translated db tblastn Translated query - Translated db tblastx MEGABLAST usa un algoritmo greedy (ingordo) veloce ed ottimizzato per comparare sequenze che differiscono poco Search for short nearly exact matches blastn con parametri scelti in modo da ottimizzare la ricerca di matches quasi esatti e brevi. Questi si trovano spesso per caso, percio’ utilizza alto Evalue, piccola dimensione della parola e filtering PSI-BLAST Find members of a protein family or build a custom position- specific score matrix PHI-BLAST Find proteins similar to the query around a given pattern


Scaricare ppt "Docente: Dr. Stefania Bortoluzzi Dipartimento di Biologia Universita' di Padova viale G. Colombo 3, 35131, Padova Tel. 0039 049 8276214"

Presentazioni simili


Annunci Google