La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Bioinformatica Allineamento di sequenze e ricerca di similarità

Presentazioni simili


Presentazione sul tema: "Bioinformatica Allineamento di sequenze e ricerca di similarità"— Transcript della presentazione:

1 Bioinformatica Allineamento di sequenze e ricerca di similarità
Dr. Giuseppe Pigola –

2 Allineamento di Sequenze
L’allineamento tra due o più sequenza può aiutare a trovare regioni simili per le quali si può supporre svolgano la stessa funzione; La similarità tra due o più sequenza può essere definita in base a una funzione distanza: Tanto più simili sono le sequenze, tanto meno distanti sono; Esistono diversi algoritmi di allineamento ciascuno dei quali definisce una funzione distanza; Dato un allineamento possiamo assegnare uno Score che indica il grado di similarità delle due sequenze. Bioinformatica

3 Allineamento di Sequenze
GLOBALE: Si cerca la corrispondenza ottimale tra tutti gli amminoacidi (nucleotidi) di entrambe le sequenze. LOCALE: Si cerca di individuare regioni locali di similarità. Globale LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK ||.  | |  |  .|     .|  ||  || | ||   TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHKAG Locale LTGARDWEDIPLWTDWDIEQESDFKTRAFGTANCHK   ||||||||.||||     TGIPLWTDWDLEQESDNSCNTDHYTREWGTMNAHKAG Bioinformatica

4 Allineamento Pairwise – Matrici Dot Plot
Si crea una matrice in cui vengono confrontati tutti i possibili appaiamenti di ogni carattere delle due sequenze da allineare. Si riempie la matrice, annerendo le caselle che hanno nella corrispondente riga e colonna la stessa lettera. Il programma DOTLET (http://myhits.isb-sib.ch/cgi-bin/dotlet) , date due sequenze in input permette di disegnare facilmente la relativa matrice Dot Plot. Bioinformatica

5 Allineamento Pairwise – Matrici Dot Plot
g e t d y h q f l k * Duplicazione Inversione Similarità Bioinformatica

6 Allineamento Pairwise – Matrici Dot Plot
FILTRAGGIO –Window Size E’ chiaro che il numero di punti della matrice è influenzato dalla natura della sequenza; Se confrontiamo due sequenze di nucleotidi (o proteine) costituite da 100 residui, assumendo che ciascun nucleotide (o aminoacido) occorra con la stessa probabilità, il numero totale di punti della matrice sarà mediamente pari a 2500 (500 nel caso di aminoacidi) su celle totali; Quando confrontiamo sequenze nucleotidiche il rumore di fondo sara più elevato; Possiamo confrontare finestre costituite da w residui contigui; In tal caso metteremo un “dot” nella cella (i,j) solo nel caso in cui le stringhe risultino identiche per s residui su w. Bioinformatica

7 DotLet - http://myhits.isb-sib.ch/cgi-bin/dotlet
Preleviamo la sequenza proteica della calmodulina umana con accession Number CAA36839; Confrontate la sequenza con se stessa per mezzo di DotLet; Lasciare come parametri iniziali la matrice Blosum62 ed una finestra di 15 residui per il confronto Bioinformatica

8 DotLet - http://myhits.isb-sib.ch/cgi-bin/dotlet
Il grafico riporta la distribuzione degli score ottenuti da tutte le coppie di finestre di sequenza confrontate (usando le matrici di score). Si noti che la maggior parte dei punteggi ricade nella distribuzione a sinistra a basso punteggio, mentre una piccola popolazione a punteggio elevato si trova a destra. Spostando i cursori si variano i punteggi limite al di sotto dei quali la cella assume il colore nero e al di sopra il colore bianco. Tra i due limiti le celle assumono un tono di grigio proporzionale al punteggio che contengono. Num di score con quel punteggio Punteggio ottenuto Bioinformatica

9 DotLet - http://myhits.isb-sib.ch/cgi-bin/dotlet
Cliccando sulla matrice si attiva un reticolo che può essere spostato sulla superficie della matrice stessa con il puntatore del mouse; In basso viene riportato l’allineamento tra i due segmenti della proteina corrispondenti alla posizione del centro del reticolo sulla matrice; Bioinformatica

10 DotLet - http://myhits.isb-sib.ch/cgi-bin/dotlet
Spostando i cursori in modo da posizionarci sulla piccola distribuzione a destra a punteggio elevato verranno visualizzati solo i punteggi elevati che ovviamente corrispondono alla diagonale principale; Bioinformatica

11 DotLet - http://myhits.isb-sib.ch/cgi-bin/dotlet
Esempio: Domini Ripetuti. Matrice Dot Plot calcolata sulla stessa sequenza di Drosophila Melanogaster (proteina SLIT). Parametri: Blosum 62, Zoom 1:5, grayscale: 53%,30% SLIT_DROME (P24014): MAAPSRTTLMPPPFRLQLRLLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHIPGGGVGVITEARCPRVCSCT GLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVI TTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSW LSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTL PDDTTDVRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLRLLL LNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSMKTVHLAKNPFICDCNLRWLADYLHKNPIETSGARCE SPKRMHRRRIESLREEKFKCSWGELRMKLSGECRMDSDCPAMCHCEGTTVDCTGRRLKEIPRDIPLHTTELLLNDNELGR ISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFE HLNSLTSLNLASNPFNCNCHLAWFAECVRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKCSSENSEGCLGDGYCPPSCT CTGTVVACSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYN KLQCLQRHALSGLNNLRVVSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCAEPEQ MKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQPGYHGKHCEFMIDACYGNPCRNNAT CTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQNNATCIDGVESYKCECQPGFSGEFCDTKIQFCSPEFNPCANGAK CMDHFTHYSCDCQAGFHGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQNHEC KHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANVTIVFSSAEQNGILMYDGQDAHLAV ELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVELLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDP AQQAYKNWQIRNLTSFKGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDPCLEN KCRRGSRCVPNSNARDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVREYYTENDCRSRQPLKYAKCVGGCGN QCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCTKKCY Bioinformatica

12 DotLet - http://myhits.isb-sib.ch/cgi-bin/dotlet
ESERCIZIO Recuperare le sequenze proteiche in formato FASTA di: subunità alfa 2 di Rattus norvegicus del recettore neuronale dell’acetilcolina (Neuronal acetylcholine receptor protein, alpha-2 chain precursor P12389); subunità alfa 4 di chicken del recettore neuronale dell’acetilcolina (Neuronal acetylcholine receptor protein, alpha-4 chain precursor P09482); Confrontare le due sequenze con DotLet per verificare la presenza di zone di somiglianza ed eventuali dissimilarità nella diagonale principale(Far variare i parametri di input); Bioinformatica

13 Allineamento Pairwise
Siano S e T due sequenze. Un allineamento A associa ad S e T le sequenze S’ e T’, che possono contenere simboli di spazio “-”, in modo che |S’|=|T’| Rimuovendo gli spazi da S’ e T’ otteniamo S e T. Se l = |S’|=|T’|, lo score di un allineamento pairwise è definito da: L’allineamento ottimale sarà quello che massimizza la similarità (lo score); Bioinformatica

14 Allineamento Pairwise
ESEMPIO: NEEDLEMAN-WUNSCH Lo score ottimale V(i,j) di due sequenze S1….i T1…j ha le seguenti proprietà: Algoritmo di programmazione dinamica per calcolare l’allineamento match/mismatch deletion insertion Bioinformatica

15 Allineamento Pairwise
ESEMPIO: NEEDLEMAN-WUNSCH j - 1 2 3 4 5 i C A D B D S2 - -1 -2 -3 -4 -5 1 A -1 -1 1 -1 -2 S1 = ACBCDB S2 = CADBD 2 C -2 1 -1 -2 3 B -3 -1 2 1 4 C -4 -1 -1 -1 1 1 5 D -5 -2 -2 1 3 Otteniamo tre allineamenti ottimali: ACBCDB- ACBCDB- -ACBCDB | || | || | | | -C-ADBD -CA-DBD CADB-D- 6 B -6 -3 -3 3 2 S1 Allineamento ottimale V(6,5) = 2 Bioinformatica

16 Allineamento Pairwise – Matrici di Score
Un modo per definire la funzione σ è ad esempio quello di assegnare 1 in caso di caratteri uguali e 0 altrimenti. Nel caso di Nucleotidi questa definizione può andare bene; Nel caso di aminoacidi non è del tutto corretto assegnare ai mismatch lo stesso peso; Per questo motivo si introducono le matrici di score che assegnano ad ogni coppia di amino acidi un punteggio: Matrici PAM (Percent Accepted Mutations): si basano su calcoli statistici; Matrici BLOSUM: sono invece basate su una banca dati (BLOCKS) di allineamenti multipli di segmenti proteici; Bioinformatica

17 Allineamento Pairwise – Matrici di Score
Seq1 V D S - C Y Seq2 V E S L C Y Score Score allineamento: 15 Penalità del gap. blosum62 Bioinformatica

18 Allineamento Pairwise - EMBOSS http://www. ebi. ac
Bioinformatica

19 Allineamento Pairwise - EMBOSS http://www. ebi. ac
Utilizziamo EMBOSS per allineare due sequenze con gli algoritmi di Needleman-Wunsch (globale); Smith-Waterman (locale); Bioinformatica

20 Allineamento Pairwise - EMBOSS http://www. ebi. ac
Selezioniamo il tipo di sequenza: Protein; DNA; Bioinformatica

21 Allineamento Pairwise - EMBOSS http://www. ebi. ac
Scelta della scoring matrix: Protein: Blosum62; Blosum50; Blosum40; DNA: DNAFull: (Assegna score diversi nel caso di mismatch di caratteri IUB-IUPAC); DNAMat: (usata da BLAST assegna uno score al match e un altro al mismatch); Bioinformatica

22 Allineamento Pairwise - EMBOSS http://www. ebi. ac
GOP e GEP; Bioinformatica

23 Allineamento Pairwise - EMBOSS http://www. ebi. ac
Inserimento delle due sequenza anche da file; Bioinformatica

24 Allineamento Pairwise - EMBOSS http://www. ebi. ac
Identity: percentuale di match identici; Similarity: percentuale di match per cui la matrice di scoring ha un valore >= 0 (si tratta di aminoacidi diversi che hanno caratteristiche chimico-fisiche simili); Bioinformatica

25 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Basic Local Alignment Search Tool Bioinformatica

26 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
BLAST (Basic Local Alignment Search Tool) Permette di ricercare regioni di similarità locale tra una sequenza data e una collezione di sequenze in banca dati. Bioinformatica

27 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
L’idea di base dell’algoritmo consiste nel procedere ad allineare passo dopo passo piccole sequenze (WORD e KTUPLE) e tentando di estendere poi l’allineamento. Bioinformatica

28 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
BLAST NUCLEOTIDICO MEGABLAST E’ utilizzato per trovare efficientemente lunghi allineamenti tra sequenze molto simili tra loro o per identificare una sequenza di input sconosciuta. Discontiguous MEGABLAST E’ utilizzato per trovare efficientemente lunghi allineamenti tra sequenze che hanno alcune differenze tra loro. BLASTN Utilizzato in tutti gli altri casi. Bioinformatica

29 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
BLAST PROTEICO BLASTP E’ utilizzato per identificare una sequenza proteica di input nel DB o per ricercare sequenze proteiche simili; PSI-BLAST Position-Specific Iterata BLAST è il programma BLAST più sensibile, il che lo rende molto utile per trovare proteine poco correlate (molto distanti). PHI-BLAST Pattern-Hit Initiated BLAST è progettato per la ricerca di proteine che contengono un pattern specificato dall'utente e sono simili alla sequenza query in prossimità del pattern. Bioinformatica

30 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
ALTRI TOOL BLASTX (Translated query vs protein database) E’ utilizzato per trovare proteine simili a quelle codificate da una query di nucleotidi; TBLASTN (Protein query vs translated database) E’ utilizzato per trovare proteine omologhe a quella data in input. Le sequenze nucleotidiche del DB vengono tradotte in sequenze aminoacidiche utilizzando tutti e sei i frame di lettura e poi contfrontate con la query. TBLASTX (Translated query vs translated database) Prende in input una sequenza nucleotidica, la traduce in tutti e sei i frame di lettura e confronta queste sequenze tradotte con il DB di nucleotidi a sua volta tradotto in Aminoacidi. Utile per trovare nuovi geni. BLAST2SEQ Utilizza BLAST per allineare due o più sequenze. Bioinformatica

31 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Scelta dei vari BLAST Inserire la sequenza in formato FASTA (anche da file) oppure specificare l’Accession Number o il Gene ID. Specificare eventualmente l’intervallo di interesse. Bioinformatica

32 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Scegliere un nome descrittivo per la ricerca che apparirà nei risultati. Selezionare se si vuole utilizzare BLAST per allineare due o più sequenze. Campo di ricerca: DB, Organismo. E’ possibile usare la sintassi di entrez per filtrare i DB selezionati. Bioinformatica

33 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Ottimizza la ricerca per: Similarità; Dissimilarità; Ricerca generica; Bioinformatica

34 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
E’ possibile cambiare la soglia di significatività statistica. Ogni match trovato ha un valore di significatività statistica, che indica quanto è statisticamente probabile che quel match sia casuale. Minore è il numero, maggiore sarà il tempo di esecuzione.L’accuratezza però cresce. Filtrare regioni il cui match avrebbe scarso significato biologico. Bioinformatica

35 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Dimensione delle Word: Maggiore è il numero, minore sarà il numero di word generate per cui minore sarà il tempo di esecuzione. L’accuratezza però decresce. Bioinformatica

36 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Esempio ricerchiamo il gene DIABLO in Drosophila Melanogaster La prima voce che troviamo è il gene cercato. Selezioniamo la sequenza corrispondente di mRNA in formato FASTA e diamola in pasto a BLAST scegliendo come DB nt e tool Megablast. Bioinformatica

37 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Dati generali Taxonomy Report ci da informazioni sulle specie coinvolte nei risultati; Può essere utile per verificare la presenza di sequenze ortologhi in altre specie; Bioinformatica

38 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Dati generali Allineamento grafico: I colori indicano la qualità dell’allineamento. Le prime due sequenze sono identiche. Bioinformatica

39 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Le prime due sequenze sono identiche alla query (per questo motivo BLAST può essere usato per ricercare sequenze sconosciute). Le altre sono sequenze parziali. Bioinformatica

40 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Scorrendo i risultati troviamo altre sequenze (anche parziali) in altri tipi di Drosophile. Bioinformatica

41 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Infine troviamo i dettagli dei vari allineamenti. I trattini indicano un match, la loro assenza indica un mismatch. Bioinformatica

42 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
MAX SCORE Punteggio dell’allineamento locale più significativo. (punteggio alto → elevata similarità); TOTAL SCORE La somma dei punteggi di tutti gli allineamenti locali trovati tra la sequenza query e le sequenze del database. QUERY COVERAGE Percentuale della sequenza allineata E-VALUE Esprime la probabilità che l’allineamento trovato sia casuale. Più basso è, maggiore è la probabilità che NON sia casuale. (dipende, oltre che dalla similarità, anche dalla numerosità delle sequenze in database e dalla lunghezza delle sequenze). MAX INDENT Percentuale di identità dell’allineamento locale più significativo. Bioinformatica

43 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
VALIDAZIONE STATISTICA e BIT SCORE La probabilità di trovare un allineamento con score maggiore o uguale di S segue la distribuzione di Poisson M,N: lunghezze delle due sequenze; λ,K: parametri che dipendono tra le altre cose dalla banca dati, dalla sua dimensione etc. Il numero atteso di sequenze che hanno per caso lo score S è Il bit-score non è altro che lo score normalizzato in modo da poter confrontare bit-score di banche dati diverse Risposta: Homo sapiens tyrosinase (usare BLAST con megablast su database NT) Bioinformatica

44 Allineamento Pairwise – BLAST2SEQ http://www.ncbi.nlm.nih.gov/BLAST
E’ possibile usare BLAST per fare un allineamento di due sequenze. In questo caso verranno evidenziate le similarità locali. Si sceglie il programma adatto, si inseriscono le sequenze e si ottiene il risultato. I parametri dell’interfaccia cambiano leggermente quanto si sceglie di allineare proteine piuttosto che nucleotidi (ad esempio le matrici di score). Bioinformatica

45 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Ritorniamo alla pagina principale di BLAST C’è una sezione dedicata ai genomi completi (o in fase di completamento); In questo modo è possibile fare un BLAST su sequenze di una data specie; Bioinformatica

46 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
Ritorniamo alla pagina principale di BLAST C’è una sezione dedicata ai genomi completi (o in fase di completamento); In questo modo è possibile fare un BLAST su sequenze di una data specie; Bioinformatica

47 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
ESERCIZIO Data la seguente sequenza sconosciuta. Determinare l’identità più probabile. >SCONOSCIUTA ATCACTGTAGTAGTAGCTGGAAAGAGAAATCTGTGACTCCAATTAGCCAGTTCCTGCAGACCTTGTGAGGACTAGAGGAAGAATGCTCCTGGCTGTTTTGTACTGCCTGCTGTGGAGTTTCCAGACCTCCGCTGGCCATTTCCCTAGAGCCTGTGTCTCCTCTAAGAACCTGATGGAGAAGGAATGCTGTCCACCGTGGAGCGGGGACAGGAGTCCCTGTGGCCAGCTTTCAGGCAGAGGTTCCTGTCAGAATATCCTTCTGTCCAATGCACCACTTGGGCCTCAATTTCCCTTCACAGGGGTGGATGACCGGGAGTCGTGGCCTTCCGTCTTTTATAATAGGACCTGCCAGTGCTCTGGCAACTTCATGGGATTCAACTGTGGAAACTGCAAGTTTGGCTTTTGGGGACCAAACTGCACAGAGAGACGACTCTTGGTGAGAAGAAACATCTTCGATTTGAGTGCCCCAGAGAAGGACAAATTTTTTGCCTACCTCACTTTAGCAAAGCATACCATCAGCTCAGACTATGTCATCCCCATAGGGACCATTGGCCAAATGAAAAATGGATCAACACCCATGTTTAACGACATCAATATTTATGACCTCTTTGTCTGGATGCATTATTATGTGTCAATGGATGCACTGCTTGGGGGATCTGAAATCTGGAGAGACATTGATTTTGCCCATGAAGCACCAGCTTTTCTGCCTTGGCATAGACTCTTCTTGTTGCGGTGGGAACAAGAAATCCAGAAGCTGACAGGAGATGAAAACTTCACTATTCCATATTGGGACTGGCGGGATGCAGAAAAGTGTGACATTTGCACAGATGAGTA Risposta: Homo sapiens tyrosinase (usare BLAST con megablast su database NT) Bioinformatica

48 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
ESERCIZIO I Ricercare le sequenze proteiche simili alla subunità IV della citocromo c ossidasi umana (Accession Number: P13073). Ci sono sequenze predette? Ci sono sequenze appartenenti a organismi non facenti parte dei mammiferi? Ci sono sequenze predette e ci sono organismi non facenti parte dei mammiferi (vertebrati). Bioinformatica

49 Similarità nei DB - BLAST http://www.ncbi.nlm.nih.gov/BLAST
ESERCIZIO II Considerare la seguente sequenza proteica del lievito: >gi| |sp|Q |CDA2_YEAST Chitin deacetylase 2 precursor MRIQLNTIDLQCIIALSCLGQFVHAEANREDLKQIDFQFPVLERAATKTPFPDW LSAFTGLKEWPGLDPP YIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHH CTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLK HNSTFFNLGVNIVQHPDIYQ RMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPY GGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGT GLILEHDSTEKTV DLAIKINKLIGDDQSTVSHCVGGIDYIKEFLS Fare una ricerca di omologia nei soli funghi. Riportare accession number e E-value della proteina più simile di Neuorspora Crassa. Riportare accession number e E-value ddella proteina più simile di Aspergillus Nidulans. Ci sono sequenze predette e ci sono organismi non facenti parte dei mammiferi (vertebrati). Bioinformatica

50 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
Sequence Similarity Search using the FASTA Bioinformatica

51 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1- Scelta del DB Bioinformatica

52 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1I - Inserimento della sequenza Bioinformatica

53 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1II - Scelta del programma: FASTA Simile a BLAST SSEARCH (Smith-Waterman); GGSEARCH (Needleman-Wunsch); TFASTX, TFASTY Confronta una proteina con un DB di DNA calcolando tutti i frame di lettura; FASTX, FASTY Confronta una sequenza nucleotidica con un DB di proteina traducendo la sequenza di input; Bioinformatica

54 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1V - Opzioni: Match/mismatch scores; GOP e GEP; Bioinformatica

55 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1V - Opzioni: KTUP: E’ alla base dell’algoritmo FASTA. Più basso è il valore più accurata e la ricerca (ma più lento sarà il programma); Esso rappresenta il minimo numero di residui contigui identici affinchè una coppia di sequenze sia considerata simile (… e quindi presa in considerazione); Expectation Upper value: Rappresenta il numero MAX di volte che il match è atteso per caso. Expectation Lower Value: Rappresenta il numero MIN di volte che il match è atteso per caso. Bioinformatica

56 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1V - Opzioni: Strand: Per le sequenze nucleotidiche specifica quale strand usare per la ricerca (NONE,BOTH, TOP,BOTTOM); Histogram: Visualizza o meno l’istogramma nei risultati. L’istogramma da un vista qualitativa dei risultati. Filter: Filtrare regioni il cui match avrebbe scarso significato biologico. Bioinformatica

57 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
STEP 1V - Opzioni: Opzioni di visualizzazione dei risutati. Bioinformatica

58 Similarità nei DB - FASTA http://www.ebi.ac.uk/Tools/sss/fasta/
Eseguiamo FASTA sulla proteina DIABLO di Drosophila Melanogaster Bioinformatica

59 Allineamento Multiplo - Clustalw http://www. ebi. ac
Multiple sequence alignment program for DNA or proteins Bioinformatica

60 Allineamento Multiplo - Clustalw http://www. ebi. ac
ALGORITMO PROGRESSIVO: Si ottengono prima tutti i possibili allineamenti di coppia e si registra il punteggio di ciascuno (Si mantiene una matrice di tutte le distanze); Con questi punteggi si costruisce un albero filogenetico in modo da visualizzare le relazioni evolutive (neighbour joining); Ad ogni passo si allineerà la coppia (seq-seq o seq-profilo o profilo-profilo) con distanza minima; La radice dell’albero conterrà l’allineamento multiplo; AGTTGG ACTTGG AGTTGG ACTTGG AGTTGG ACTTGG AG__GG CCTTGG AGGG AG__GG CCTTGG AGTTGG CCTTGG CCTTGG AGTTGG AGTTGC Bioinformatica

61 Allineamento Multiplo - Clustalw http://www. ebi. ac
PROFILI: Dato un allineamento multiplo M di N sequenze di lunghezza L , un profilo P è una matrice | ∑{-}|  L le cui colonne denotano le freaquenze di ogni simbolo nella corrispondente colonna dell’allineamento; 1 2 3 4 5 6 7 8 A T G C - A-GTT—TA AC-TTA-- ACGTAAG- -C-TA--- Bioinformatica

62 Allineamento Multiplo - Clustalw http://www. ebi. ac
ALLINEARE UNA SEQUENZA CON UN PROFILO: Sia P =(pij) per i=1… |∑|+1 e j=1… L un profilo, e sia S=s1…sn una sequenza. Possiamo definire la seguente funzione di score: σsp: (∑ {-}) {1,2,…,L}  R Bioinformatica

63 Allineamento Multiplo - Clustalw http://www. ebi. ac
ALLINEARE DUE PROFILI: Siano P1 =(pij) e P2 =(pik) per i=1… |∑|+1, j=1… L’ k=1…L’’, due profili. Possiamo definire la funzione di score: σpp: {1,2,…,L’}{1,2,…,L’’}  R Rimpiazzando la funzione di score σ con σpp l’allineamento di due allineamenti multipli si riduce al confronto di due profili; Bioinformatica

64 Allineamento Multiplo - Clustalw http://www. ebi. ac
ESEMPIO PRATICO: Vogliamo allineare le sequenze aminoacidiche della proteina NAD6 dei metazoi ma non dei mammiferi; Utilizziamo SRS; Selezioniamo “Library Page”; Scegliamo il DB “Uniprotkb-SwissProt”; Clicchiamo su “Standard Query Form”; Bioinformatica

65 Allineamento Multiplo - Clustalw http://www. ebi. ac
Impostiamo la Query Bioinformatica

66 Allineamento Multiplo - Clustalw http://www. ebi. ac
Salviamo i risultati in un file di testo nel formato “fasta2seqs”; Bioinformatica

67 Allineamento Multiplo - Clustalw http://www. ebi. ac
Sul sito di ClustalW facciamo un upload delle sequenze e lanciamo il tool Bioinformatica

68 Allineamento Multiplo - Clustalw http://www. ebi. ac
Risultato dell’allineamento: Formato testuale e colori. Bioinformatica

69 Allineamento Multiplo - Clustalw http://www. ebi. ac
Sommario: Tabella delle distanze Bioinformatica

70 Allineamento Multiplo - Clustalw http://www. ebi. ac
JALVIEW: Permette di visualizzare/editare l’allineamento (modificando / cancellando / inserendo amino acidi) Colori: Ad ogni aminoacido (o simili) è assegnato un colore; Conservation: misura il numero di proprietà fisico-chimiche conservate per ogni colonna dell'allineamento. Quality: Qualità dell’allineamento in base alla matrice di score utilizzata. Consensus: Aminoacido più conservato in ogni posizione (compreso il simbolo di gap). Se ci sono più consensi viene indicato il simbolo +; Bioinformatica

71 Allineamento Multiplo - Clustalw http://www. ebi. ac
Albero filogenetico ricavato dall’allineamento progressivo (i rami hanno lunghezza proporzionale alla distanza tra le sequenze) . Bioinformatica

72 Allineamento Multiplo - Clustalw http://www. ebi. ac
OPZIONI. Si seleziona il tipo di sequenza; Si incollano le sequenze o si fa un upload di un file; Bioinformatica

73 Allineamento Multiplo - Clustalw http://www. ebi. ac
OPZIONI. Pairwise Alignment Type: Slow (lento ma accurato); Fast (veloce ma approssimato); Bioinformatica

74 Allineamento Multiplo - Clustalw http://www. ebi. ac
OPZIONI. SLOW OPTIONS Matrici di score; GOP; GEP; Bioinformatica

75 Allineamento Multiplo - Clustalw http://www. ebi. ac
OPZIONI. FAST OPTIONS KTUP: Più basso è il valore più accurata e la ricerca (ma più lento sarà il programma); Esso rappresenta il minimo numero di residui contigui identici affinchè una coppia di sequenze sia considerata simile; WINDOW LENGTH: Dimensione della finestra in cui vengono ricercati i residui contigui. Decrementare per velocizzare la ricerca; Incrementare per aumentare l’accuratezza. SCORE TYPE: Percentuale o valore assoluto; TOPDIAG: Decrementare per velocizzare; Incrementare per aumentare l’accuratezza. PAIRGAP: Gap penalty; Bioinformatica

76 Allineamento Multiplo - Clustalw http://www. ebi. ac
OPZIONI. Multiple Alignment Type: Matrici di score; GOP e GEP; GAP Distances: Penalità assegnata a gap troppo vicini; NO ENDS GAPS: Riferito alla voce precedente per i gap alla fine delle sequenze; Iteration: Migliora la qualità dell’allineamento (NO, Ad ogni step, solo all’ultimo allineamento). CLUSTERING: Tipo di clustering: Neighbour Joining etc.; Output Format; Bioinformatica

77 Allineamento Multiplo - Clustalw http://www. ebi. ac
ESERCIZIO I: Identificare le sequenze corrispondenti della proteina (avente 214aa) umana shp-2 in topo, ratto e drosophila con E-value migliore. Costruirne l'allineamento multiplo; Quale è la parte più conservata? Visualizzare l’albero filogenetico e trarne le dovute considerazioni. Bioinformatica

78 Allineamento Multiplo - Clustalw http://www. ebi. ac
ESERCIZIO II: Utilizzando Entrez o SRS, estrai le sequenze in formato Fasta delle proteine aventi i seguenti accession number: P96551, P47700, P48525, O33120 e O25360 e prendi nota degli organismi a cui appartengono; Conservare le sequenze fasta in un file; Lanciare ClustalW; A quale organismo appartiene la sequenza più lunga e di quanti aminoacidi è composta? Quali sono gli AC della coppia con score più alto? Bioinformatica

79 Allineamento Multiplo - Clustalw http://www. ebi. ac
ESERCIZIO III: Recuperare le sequenze proteiche in formato fasta YP_ , YP_ , YP_ , NP_ , YP_ , YP_ , ZP_ Lanciare ClustalW; Visualizzare e commentare l’albero filogenetico. Bioinformatica

80 Allineamento Multiplo – TCoffee http://www. ebi. ac
Bioinformatica

81 Allineamento Multiplo – TCoffee http://www. ebi. ac
T-Coffee (Tree-based Consistency Objective Function for alignment Evaluation) Dato un insieme di sequenze un allineamento è ottimale se esso è il più possibile consistente con tutti i possibili allineamenti pairwise ottimali; STEP 1: Viene generata una “Primary Library” contenente un insieme di allineamenti pair-wise tra tutte le sequenze di input. Allineamenti globali: tra tutte le coppie di sequenze (ClustalW); Allineamenti locali: I primi 10 migliori allineamenti locali per ogni coppia di sequenze (lalign); Ogni coppia di residui ha inizialmente un peso pari a quello dato dalla identità percentuale; Le due librerie vengono combinate in una sola con un semplice processo additivo: se una coppia di residui è presente in entrambe, viene fusa in una sola entry il cui peso è dato dalla somma dei pesi; Bioinformatica

82 Allineamento Multiplo – TCoffee http://www. ebi. ac
Libreria primaria di allineamenti pairwise globali Tutte le coppie di sequenze in input vengono allineate mediante ClustalW. Per ogni allineamento pairwise viene calcolata l’identità percentuale: Dove sim(S1,S2) è il numero dei match nell’allineamento e pos il numero delle coppie allineate di residui escluse quelle in cui compare un gap. S1) A C A - G – T C A S2) A G - T G C T – T Bioinformatica

83 Allineamento Multiplo – TCoffee http://www. ebi. ac
Nella libreria ogni allineamento pairwise è rappresentato come una lista di coppie di residui pesati (constraint list); Inizialmente ogni coppia di residui riceve un peso equivalente alla sequence identity dell’allineamento da cui proviene: S1) A C A - G – T C A S2) A G - T G C T – T Seq1 Seq2 Res1 Res2 Weight S1 S S1 S S1 S S1 S S1 S Bioinformatica

84 Allineamento Multiplo – TCoffee http://www. ebi. ac
Viene creata una seconda libreria a partire dagli allineamenti locali creati con LAlign, un tool del pacchetto FASTA; L’allineamento locale di una coppia di sequenze S1, S2 consiste nell’allineamento di sottosequenze di S1 ed S2, al fine di mettere in evidenza eventuali regioni ad alta similarità: LAlign restituisce i 10 migliori allineamenti locali (in termini di similarità) della coppia di sequenze in input; Una volta individuato l’allineamento locale con il massimo score, LAlign cerca il successivo escludendo dalla ricerca le due regioni appena trovate: in questo modo gli allineamenti prodotti non si intersecheranno. S1 S2 Bioinformatica

85 Allineamento Multiplo – TCoffee http://www. ebi. ac
A partire dalle due librerie globale e locale viene creata un’unica libreria primaria mediante una semplice operazione di addizione; Le coppie di residui comuni vengono sostituite da un’unica entry il cui peso è la somma dei due pesi, mentre tutte le altre coppie vengono trascritte così come sono: Global Alignments by ClustalW Seq1 Seq2 Res1 Res2 Weight S1 S S1 S S1 S S1 S S1 S Local Alignments by LAlign Seq1 Seq2 Res1 Res2 Weight S1 S S1 S S1 S S1 S S1 S Primary Library Seq1 Seq2 Res1 Res2 Weight S1 S S1 S S1 S S1 S S1 S S1 S S1 S Bioinformatica

86 w(x,y) + min(w(x,z),w(z,y))
Allineamento Multiplo – TCoffee STEP II: Calcolo dei pesi nella “Extended Library”. Ad ogni coppia di residui allineati nella libreria viene assegnato un peso in base agli altri allineamenti pairwise; Date due sequenze S1 e S2. Allineamo prima S1 e poi S2 con le rimanenti; Fatto l’allineamento tra S1 e Zi e S2 e Zi: se i residui x di S1 e y di S2 sono allineati con lo stesso residuo z di Zi allora il peso della coppia di residui w(x,y) viene incrementato ponendolo uguale a: w(x,y) + min(w(x,z),w(z,y)) Altrimenti nella libreria vengono inserite altre due coppie (x,z) e (z,y) con i relativi pesi; STEP III: Esegue l’allineamento progressivo utilizzando la libreria al posto delle matrici di score; Bioinformatica

87 Allineamento Multiplo – TCoffee http://www. ebi. ac
Quattro sequenze e il relativo allineamento progressivo con ClustalW SeqA GARFIELD THE LAST FAT CAT SeqB GARFIELD THE FAST CAT SeqC GARFIELD THE VERY FAST CAT SeqD THE FAT CAT SeqA GARFIELD THE LAST FA-T CAT SeqB GARFIELD THE FAST CA-T --- SeqC GARFIELD THE VERY FAST CAT SeqD THE FA-T CAT SeqA GARFIELD THE LAST FA-T CAT SeqB GARFIELD THE ---- FAST CAT SeqC GARFIELD THE VERY FAST CAT SeqD THE FA-T CAT from Notredam et al. 2000 Bioinformatica

88 Allineamento Multiplo – TCoffee http://www. ebi. ac
SeqA GARFIELD THE LAST FAT CAT SeqB GARFIELD THE FAST CAT --- SeqA GARFIELD THE LAST FA-T CAT SeqC GARFIELD THE VERY FAST CAT SeqD THE ---- FAT CAT SeqB GARFIELD THE ---- FAST CAT SeqC GARFIELD THE VERY FAST CAT SeqB GARFIELD THE FAST CAT SeqD THE FA-T CAT SeqD THE ---- FA-T CAT STEP I: Library of pairwise alignments STEP II: Per ogni coppia di sequenze controlla l’allineamento di ogni coppia di residui usando gli altri allineamenti; Consistency SeqA GARFIELD THE LAST FAT CAT |||||||| ||| |||| ||| SeqB GARFIELD THE FAST CAT --- |||||||| ||| |||| || \ \\\ SeqC GARFIELD THE VERY FAST CAT |||||||| ||| |||| |||| ||| SeqB GARFIELD THE FAST CAT ||| ||| ||| SeqD THE FAT CAT ||| ||\ \\\ Extended library SeqA GARFIELD THE LAST FAT CAT SeqB GARFIELD THE FAST CAT I pesi sono utilizzati nell’allineamento finale progressivo al posto delle matrici di score Per esempio la coppia A(G),B(G) avrà un peso dato da: w(A(G),B(G)) + min(w(A(G),C(G)) w(C(G),B(G))) Programmazione dinamica SeqA GARFIELD THE LAST FA-T CAT SeqB GARFIELD THE ---- FAST CAT Bioinformatica

89 Allineamento Multiplo – TCoffee http://www. ebi. ac
L’algoritmo: Calcolo degli allineamenti pairwise con ClustalW; Calcolo degli allineamenti locali con LAlign (10 migliori allineamenti per ogni coppia di sequenza) Calcolo della primary library con i relativi pesi; Estensione della libreria con il calcolo dei pesi in base a tutti gli allineamenti pariwise; Allineamento progressivo usando i pesi per ogni coppia di residui al posto delle matrici di score; ClustalW global Pairwise alignments LAlign local pairwise alignments Weighting Primary library Extension Extended library Progressive alignment A B C Bioinformatica

90 Allineamento Multiplo – TCoffee http://www. ebi. ac
Tool Online sul sito di EMBL Bioinformatica

91 Allineamento Multiplo – TCoffee http://www. ebi. ac
Esempio di Output del tutto simile a quello di ClustalW; Bioinformatica

92 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Bioinformatica

93 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Antipole Clustering Algorithm sostituisce l’albero guida di ClustalW per la costruzione dell’allineamento multiplo; Permette di velocizzare il processo di allineamento con risultati paragonabili o migliori a quelli ottenuti con ClustalW; Il metodo di allineamento può essere riassunto in: Costruire l’albero di clustering (rappresenta l’albero filogenetico); Allinea progressivamente le sequenze partendo dalle foglie fino alla radice che conterrà l’allineamento finale; Bioinformatica

94 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
CLUSTERING: Presupposto: Sequenze lontane saranno sicuramente in cluster diversi. 1-Mediana approssimata per il calcolo del diametro; Splittare il dataset in due cluster; Applicare ricorsivamente il metodo fin quando la dimensione dei cluster supera un certo parametro σ; Bioinformatica

95 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana Sia S un database di oggetti in uno spazio metrico, dato il numero intero k, il problema della k-mediana per S consiste nel trovare k oggetti c1, c2, …, ck in S che minimizzano: Per k = 1 il problema è chiamato 1-mediana e consiste nel ricercare un elemento tale che la seguente funzione è minimizzata: Bioinformatica

96 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

97 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

98 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

99 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

100 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

101 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

102 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

103 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata Bioinformatica

104 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
1-Mediana approssimata The final winner Bioinformatica

105 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Pseudo Diametro: Se ad ogni step eliminiamo l’elemento centrale e manteniamo gli altri due elementi, applicando lo stesso algoritmo possiamo calcolare un diametro approssimato (cioè la coppia di elementi più distanti); Bioinformatica

106 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree Bioinformatica

107 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree B >s A Bioinformatica

108 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree SB SA B >s A Bioinformatica

109 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree SB SA A1 B A >s A2 Bioinformatica

110 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree SB SA SA1 A1 B A >s SA2 A2 Bioinformatica

111 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree SB SA CA1 A1 B A CA2 A2 Bioinformatica

112 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree B1 SB SA CA1 A1 B >s A B2 CA2 A2 Bioinformatica

113 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree SB1 B1 SB SA CA1 A1 B A B2 CA2 A2 SB2 Bioinformatica

114 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree CB1 B1 SB SA CA1 A1 B A B2 CA2 A2 CB2 Bioinformatica

115 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruzione dell’Antipole Tree CB1 B1 CA1 A1 B2 CA2 A2 CB2 Bioinformatica

116 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
How to align two clusters How to align the sequences in a cluster Multiple sequence alignment via the Antipole tree Bioinformatica

117 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Costruisce una libreria di pesi per ogni coppia di residui allo stesso modo di T- Coffee; Le sequenze sono clusterizzate con l’algoritmo Antipole; L’albero antipole è visitato in modo bottom-up producendo una “Level Matrix”: Ad ogni step se due sequenze si trovano assieme nello stesso cluster, la corrispondente entry nella matrice viene incrementato; Alla fine la “Level Matrix” darà un indice di similarità tra le sequenze; Tale matrice verrà usata per raffinare la libreria che alla fine verrà usata per l’allineamento vero e proprio allo stesso modo di T-Coffee; Bioinformatica

118 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Formato di Output: FASTA, GCG, etc; Metodi per calcolare la libreria: ClustalW, FASTA etc. Programmazione dinamica: Myers and Miller, FASTA, etc. Usare un albero filogenetico precalcolato; Bioinformatica

119 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
Metric: CRISP o PAM; Diameter: Distanza per cui due sequenze sono considerate diverse; GOP e GEP; Metodo di vista dell’albero antipole: Right Left o Left Right; Web Logo: E’ una rappresentazione grafica dell’allineamento; Si possono fornire i residui di Start e End per la rappresentazione grafica; Bioinformatica

120 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
ESEMPIO: Risultati di un allineamento con tutti gli elementi scaricabili; Bioinformatica

121 Allineamento Multiplo – Anticlustal http://alfredo.dmi.unict.it/ac2/
ESERCIZIO: Utilizzando Entrez o SRS, estrai le sequenze in formato Fasta delle proteine aventi i seguenti accession number: P96551, P47700, P48525, O33120 e O25360 e prendi nota degli organismi a cui appartengono; Conservare le sequenze fasta in un file; Confrontare l’albero filogenetico costruito con ClustalW e quello ottenuto dall’algoritmo antipole. Ci sono differenze? Bioinformatica

122 Allineamento Multiplo – MUSCLE http://www.ebi.ac.uk/Tools/msa/muscle/
MUSCLE: MUltiple Sequence Comparison by Log- Expectation Bioinformatica

123 Allineamento Multiplo – MUSCLE http://www.ebi.ac.uk/Tools/msa/muscle/
Stage 1 Stage 2 Stage 3 Bioinformatica

124 Allineamento Multiplo – MUSCLE http://www.ebi.ac.uk/Tools/msa/muscle/
Stage 1 Stage 2 Stage 3 Bioinformatica

125 MUSCLE - Stage 1 Calcola la kmer distance tra tutte le coppie di sequenze; Similmente al neighbor- joining, con tali distanze viene calcolato il guide tree basato su UPGMA (Unweighted Pair Group Method with Arithmetic mean); Calcola l’allineamento progressivo; Bioinformatica

126 kmer distance Date due sequenze X e Y la kmer similarity è così definita: dove t è un kmer (una sottosequenza di lunghezza k) lX , lY lunghezze delle sequenze nX(t), nY(t): numero di volte che t occorre in X e Y srispettivamente La similarità è definita come la frazione di kmers che sono conservati tra le due sequenze (la distanza è definita come 1-dXY) Sequenze correlate tendono ad avere molti kmers in comune rispetto a quelle attese per caso. E’ più veloce. MUSCLE usa inoltre un alfabeto compresso (classi di amino acidi). A k-mer is a contiguous subsequence of length k, also known as a word or k-tuple. Related sequences tend to have more k-mers in common than expected by chance, provided that k is not too large and the divergence is not too great. Many sequence comparison methods based on k-mer counting have been proposed in the literature The primary motivation for these measures is improved speed as no alignment is required. Bioinformatica

127 MUSCLE - Stage 2: Improved progressive
Utilizzando l’allineamento del primo step, vengono estratti tutti gli allineamenti pairwise che ne derivano; Viene calcolata la Kimura distance tra tutte le coppie di sequenze; Viene calcolato un nuovo albero usando queste distanze; Viene calcolato un nuovo allineamento multiplo con l’allineamento progressivo; The fractional identity D computed from a global alignment of two sequences is often used as a similarity measure For closely related sequences 1 - D is a good approximation to a mutation distance As sequences diverge, there is an increasing probability of multiple mutations at a single site. To correct for this, we use the following distance estimate dKimura = -ln (1 - D - D2/5) Bioinformatica

128 Kimura Distance Gli score generalemente sono calcolati come la percentuale di match nel migliore allineamento (gap e indel hanno lo stesso score). Tale score è chiamato fractional identity D e1- D è una buona approssimazione della distanza evolutiva reale per sequenze simili. Per sequenze con bassa similarità viene utilizzata la distanza di Kimura che tiene in considerazione l’alta probabilità che delle mutazioni possono verificarsinella stessa posizione. Dkimura = ln (1- D – D2/5) A k-mer is a contiguous subsequence of length k, also known as a word or k-tuple. Related sequences tend to have more k-mers in common than expected by chance, provided that k is not too large and the divergence is not too great. Many sequence comparison methods based on k-mer counting have been proposed in the literature The primary motivation for these measures is improved speed as no alignment is required. Bioinformatica

129 MUSCLE - Stage 3:Refinement
Sceglie un arco random nell’albero; Divide le sequenze in due set; Estrae i due allineamenti multipli (profile) corrispondenti; Rellainea i due profili; Accetta il nuovo allineamento se gli score (Sum of Pair) sono migliori; Itera; Bioinformatica

130 Allineamento Multiplo – MUSCLE http://www.ebi.ac.uk/Tools/msa/muscle/
Bioinformatica

131 Allineamento Multiplo – MUSCLE http://www.ebi.ac.uk/Tools/msa/muscle/
Bioinformatica

132 Allineamento Multiplo – PROBCONS http://probcons.stanford.edu/
Bioinformatica

133 Allineamento Multiplo – PROBCONS http://probcons.stanford.edu/
L’algoritmo: Calcola le Pair HMM posterior probabilities per ogni coppia di sequenze; Calcola la maximum expected accuracy tra tutte le coppie di sequenze; Applica la probabilistic consistency transformation alle posterior probabilities; Calcola il guide tree dai valori maximum expected accuracy; Allinea le sequenze progressivamente usando il guide tree; Raffina iterativamente l’allineamento multiplo; Bioinformatica

134 First order Hidden Markov Model (HMM)
Hidden states transition probabilities (between hidden states) H1 H2 HL-1 HL Hi emission probabilities (probability that a given observation symbol was generated by a hidden state) X1 X2 Xi XL-1 XL Observed symbols Three problems Evaluation (Computed with forward and backward probabilities) Given a model M and an observation x, Compute Pr[ x | M ] Decoding (Viterbi Algorithm or Posterior Decoding) Identify a hidden state  sequence which maximizes Pr[ x,  | M ] Likelihood of evidence Given a model M with unspecified transition emission probabilities and an observation x Pr[x| M] Markov Property: The state of the system at time i+1 depends only on the state of the system at time i Bioinformatica Durbin et al. (1998)

135 Pair HMMs M  Pr[(a,b) | M] = pab IS  Pr[(a,-) | IS] = qa
START M Ps[i]t[j] IS qs[i] IT qt[j] e d END t With pair HMMs Viterbi algorithm can be used to compute the optimal pairwise alignment of two sequences; computing if two sequences are related to the pair HMM using the forward algorithm; finding the posterior probabilities of an alignment, an aligned pair of symbols; computing the expected accuracy of a given alignment. Transition probabilities: With pair HMMs Viterbi algorithm can be used to compute the optimal pairwise alignment of tow sequences; computing if two sequences are related to the pair HMM using the forward algorithm; finding the posterior probabilities of an alignment, an aligned pair of symbols, computing the expected accuracy of a given algnment. Emission probabilities: M  Pr[(a,b) | M] = pab IS  Pr[(a,-) | IS] = qa IT  Pr[(-,a) | IT] = qa start M IS IT end -- 1-2δ-τ δ τ 1-ε-τ ε 1 Bioinformatica BLOSUM estimation Durbin et al. (1998)

136 PHMM posterior probabilities for each pair of sequences
PHMM posterior probabilities for each pair of sequences. Reliability measure for each part of an alignment e IS qs[i] Given two residues si, tj from sequence S and T of length n and m Uses forward and backward algorithms for Pair HMM to compute posterior probabilities that si and tj are matched in the alignment (the true biological one) d M Ps[i]t[j] d IT qt[j] The probability of any single complete path being entirely correct is small. Analyze the local accuracy of an alignment could result very useful. Often part of an alignment is fairly clear and other regions are less certain. Given this situation. it can be useful to be able to give a reliability measure for each part of an alignment. e Will be equal to 1 when si and tj are aligned in a, 0 otherwise The probability of any single complete path being entirely correct is small. To analyze the local accuracy of an alignment could result very useful. Often part of an alignment is fairly clear and other regions are less certain. It can be useful to be able to give a reliability measure for each part of an alignment. Bioinformatica

137 Compute the maximum expected accuracy
Compute an alignment a by align sequences with simple Needleman-Wunsch algorithm Using the posterior probabilities as the match and mismatch scores Set Gap penalties to 0 The goal is to find an alignment a which maximizes the expected accuracy (try to identify a* -- the best alignment -- for all sequence pairs). This can be expressed in function of posterior match probabilities. Expected accuracy can be evaluated in function of the posterior probabilities values Bioinformatica

138 Probabilistic consistency
Apply probabilistic consistency approximating it using matrix multiplication. The probability of residues si and tj being aligned given the set of all sequences Bioinformatica

139 Guide tree computation and progressive alignment
Use UPGMA as guide tree built using maximum expected accuracy distances Perform profile alignment with sum-of-pairs with maximal expected accuracy scoring No gap penalties Bioinformatica

140 Iterative refinement Randomly partition sequences into two sets
Extract multiple alignments for both sets from current multiple alignment Re-align two multiple alignments No gap penalty, sum-of-pairs scoring guaranteed to increase or stay the same Bioinformatica

141 ProbCons is a PHMM model-based progressive alignment which
uses Maximum Expected Accuracy and integrates probabilistic consistency transformation. Bioinformatica

142 Allineamento Multiplo – PROBCONS http://probcons.stanford.edu/
Bioinformatica


Scaricare ppt "Bioinformatica Allineamento di sequenze e ricerca di similarità"

Presentazioni simili


Annunci Google