La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

LA LAUREA MAGISTRALE IN BIOINFORMATICA Università degli studi di Milano-Bicocca Facoltà di Scienze MFN.

Presentazioni simili


Presentazione sul tema: "LA LAUREA MAGISTRALE IN BIOINFORMATICA Università degli studi di Milano-Bicocca Facoltà di Scienze MFN."— Transcript della presentazione:

1 LA LAUREA MAGISTRALE IN BIOINFORMATICA Università degli studi di Milano-Bicocca Facoltà di Scienze MFN

2 Che cos'è la BIOINFORMATICA? Il termine BIOINFORMATICS è stato inventato da P. Hogeweg nel 1978 La BIOINFORMATICA è una applicazione della INFORMATION TECHNOLOGY al campo della BIOLOGIA.

3 Il primo scopo della bioinformatica è CONTRIBUIRE AD AUMENTARE IL LIVELLO DI CONOSCENZA DEI SISTEMI BIOLOGICI Un altro scopo è quello di far progredire tutte le metodologie caratteristiche della bioinformatica stessa.

4 * SEQUENCE ANALYSIS * GENE FINDING * GENOME ASSEMBLY * PROTEIN STRUCTURE PREDICTION * PROTEIN-LIGAND INTERACTION * ANALYSIS OF GENE EXPRESSION * MODELLING OF METABOLIC NETWORKS * MODELLING OF EVOLUTION * SYSTEMS BIOLOGY La Bioinformatica si occupa di

5 Nei primi anni della bioinformatica i temi di studio erano essenzialmente quelli in 1-4 (analisi di sequenze) Gli sviluppi successivi e le espansioni della bioinformatica a settori diversificati sono dovuti essenzialmente ai seguenti fattori

6 i) Aumento delle potenze di calcolo (in trent'anni di almeno TRE ordini di grandezza) ii) Sviluppo delle metodologie numeriche e degli algoritmi per studiare sistemi complessi iii) Sviluppo della teoria dei sistemi

7 Allo sviluppo della BIOINFORMATICA concorrono le discipline Informatica Biologia Molecolare Biochimica Genetica Chimica Fisica Matematica

8 Proprio per il carattere INTERDISCIPLINARE della BIOINFORMATICA e importante che laureati in diverse discipline scientifiche abbiano accesso alla LAUREA MAGISTRALE La laurea magistrale è stata modificata proprio a tale scopo, per l'anno accademico Sedi italiane : Milano-Bicocca, Bologna, Roma (Tor Vergata)

9 Comparazione di sequenze proteiche. Evoluzione molecolare e funzione Primary sequence (PE and SE, ~ aa): 68.2% identity Primary sequence (PE and SE, ~ aa ): 68.2% identity 76 amino acidic substitutions (45 completely unrelated aa). 76 amino acidic substitutions (45 completely unrelated aa). Maiale VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEH Bovina VVGGTAVSKNSWPSQISLQYKSGSSWYHTCGGTLIKQKWVMTAAHCVDSQMTFRVVLGDH MerluzzoB VVGGEDVRVHSWPWQASLQYKSGNSFYHTCGGTLIAPQWVMTAAHCIGSR-TYRVLLGKH Salmone VVGGRVAQPNSWPWQISLQYKSGSSYYHTCGGSLIRQGWVMTAAHCVDSARTWRVVLGEH **.*. ::** * ***.. : *.***:*: **:*****:. :** :* * Maiale NLNQ-NNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGT Bovina NLSQ-NDGTEQYISVQKIVVHPSWNSNNVAAGYDIAVLRLAQSATLNSYVQLGVLPQSGT MerluzzoB NMQDYNEAGSLAISPAKIIVHEKWD-SSRIRNDIALIKLASPVDVSAIITPACVPDAEV Salmone NLNT-NEGKEQIMTVNSVFIHSGWNSDDVAGGYDIALLRLNTQASLNSAVQLAALPPSNQ.: :.:.:* *: *:*::::.. :. :* Maiale ILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDG Bovina ILANNTPCYITGWGRTKTNGQLAQTLQQAYLPSVDYATCSSSSYWGSTVKTTMVCAGGDG MerluzzoB LLANGAPCYVTGWGRLWTGGPIADALQQALLPVVDHAHCSRYDWWGSLVTTSMVCAGGDG Salmone ILPNNNPCYITGWGKTSTGGPLSDSLKQAWLPSVDHATCSSSGWWGSTVKTTMVCAGG-G :*.. **:**** *.*. *:*. :.: ** :*** :. *:*.** *

10 Predizione della struttura 3D delle proteine con tecniche di homology modelling Templati utilizzati per la generazione del modello Modello per omologia

11 Analisi della struttura delle proteine (relazioni tra struttura e funzione) Secondary Structure (SS) content Solvent accessible surface

12 Individuazione dei siti recettoriali Individuazione di cavità e probabili siti di legame Le sfere evidenziano delle cavità nella proteina, inoltre ci forniscono informazioni sulle caratteristiche di idrofobicità e idrofilia del ligando Sito principale Siti secondari

13 Molecular modelling, MM, MD, site_finder In silico ADME MOO Library generation, QM, 350 Molecular Descriptors, Docking 10 6 compounds 10 2 compounds potentilally LEADS Docking

14 I network proteici possiedono delle proprietà computazionali, che derivano dal fatto che le proteine sono parte di moduli la cui funzione dipende dalla struttura della proteina e dalla topologia del network in cui e coinvolta Yeast protein interaction network[Jeong et al., Nature (2001)] Problemi: network molto complicati dove e difficile individuare moduli network solo parzialmente noti Bioinformatica

15 Reti regolatorie e reti metaboliche

16

17


Scaricare ppt "LA LAUREA MAGISTRALE IN BIOINFORMATICA Università degli studi di Milano-Bicocca Facoltà di Scienze MFN."

Presentazioni simili


Annunci Google