La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

Gene Funzione Fenotipo??? mutante T-DNA REVERSE PCR-screening.

Presentazioni simili


Presentazione sul tema: "Gene Funzione Fenotipo??? mutante T-DNA REVERSE PCR-screening."— Transcript della presentazione:

1 Gene Funzione Fenotipo??? mutante T-DNA REVERSE PCR-screening

2 La grande disponibilità di sequenze geniche conseguenti alla diffusione delle tecniche di sequenziamento del DNA e, specialmente, i grandi progetti di sequenziamento genomici, hanno rivoluzionato lapproccio alla determinazione della funzione di un gene. Frequentemente oggi si fa il percorso contrario; si parte da una sequenza genica ben caratterizzata e si risale alla sua funzione. Infatti, è possibile analizzare apposite librerie di mutanti per identificare tutti i mutanti di un gene dinteresse e conoscerne i fenotipi mutanti. Questo approccio che parte dal gene per risalire alla funzione è nota come genetica inversa (reverse genetics).

3 Strategie di screening per reverse genetics Pooling Strategy e Screening per PCR Random Sequencing Strategy: Analisi di banche dati di FST (Flanking Sequence Tags)

4 48 linee indipendenti /pool (72 inserzioni T-DNA ) 384 linee (576 inserzioni T- DNA ) Super Pool A.1 Super Pool A.2 Hyper Pool A linee (1152 inserzioni T-DNA ) Hyper Pool A1.1 50,000 linee (75,000 inserzioni) > 95% saturazione MegaPool 1536 linee (2304 inserzioni T-DNA ) Pool 1Pool 8 48 x 8 Collezione di mutanti inserzionali

5

6 Protocollo di Screening Qualità dei primers: specificità-sensibilità background con i primers T-DNA Screening per PCR di n HP: combinazione di un primer gene-specifico (F/R) ed un primer T-DNA (RB/LB) Analisi per ibridazione (transfer sandwich): sonda T-DNA (RB+LB) sonda gene-specifica Segnali coincidenti con le 2 sonde: PCR di conferma con primers T-DNA nested o con primers gene-specifici sequenza del frammento amplificato

7 T-DNA 53 Scelta dei Primers gene-specifici T-DNA

8 Analisi fenotipica La base di qualunque strategia di mutagenesi è lanalisi fenotipica. Dopo aver effettuato la mutagenesi numerosi geni risulteranno mutati. Forse alcuni geni, per caso, non avranno subito alcuna mutazione, mentre in altri casi si potrebbero ottenere mutanti, con diversi livelli di perdita di funzione. Poichè le mutazioni sono di solito recessive, il primo passo consiste sempre in unautofecondazione e nel passaggio alla T2. Qualora fossero presenti alleli mutati, un quarto di essi nella progenie risulterà omozigote e potrà manifestare nelle condizioni appropriate un fenotipo rispetto al wt. In alcuni casi però la mutazione è sterile o addiritura letale; in questi casi la si propaga allo stato eterozigote. Per identificare i fenotipi mutanti si effettua uno screening, in diverse condizioni di crescita. In alcuni casi le mutazioni sono facilmente visualizzabili anche a livello macroscopico. In altri casi, invece le mutazioni sono criptiche e si può cercare di evidenziare un fenotipo facendo crescere le piante in condizioni particolari.

9 Un esempio: Isolamento di mutanti inserzionali in geni appartenenti alla famiglia Dof

10 PROTEINE DOF (DNA binding with One Finger) Fattori trascrizionali specifici del regno vegetale Caratterizzate da un singolo motivo zinc finger CX 2 C- X 21 -CX 2 C Il dominio Dof presenta unidentità aminoacidica del % Generalmente non presentano grosse omologie al di fuori del dominio conservato

11 1 [.... :.] 61 1 DOF15_67_125 LNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSSS-- 2 DAG1_74_132 VNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTP-- 3 DOF8_53_111 VNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSHSS-- 4 DOF24_35_93 LNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCRRYWTAGGSLRNIPVGGGVRKNKRSSSN-- 5 DOF10_349_407 RNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKKLPFP-- 6 DOF23_35_93 LRCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKRSTSS-- 7 DOF6_40_98 LRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKRSSSA-- 8 DOF11_73_131 QKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPSSS-- 9 DOF20_19_77 QNCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKRSSSS-- 10 DOF28_25_83 PSCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRPKSS-- 11 DOF31_38_96 PACPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRSRQN-- 12 HPPBF-2a_110_168 LPCPRCKSMETKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKNKSSSSH-- 13 DOF12_152_210 LPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSPASH-- 14 DOF13_54_112 LPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNSPT-- 15 HPPBF-2b_132_190 IPCPRCESANTKFCYYNNYNVNQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKNKGWPSS-- 16 DOF16_56_114 LPCPRCNSADTKFCYYNNYNVNQPRHFCRKCQRYWTAGGSMRIVPVGSGRRKNKGWVSS-- 17 DOF29_62_120 IPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSKPPGRV-- 18 DOF9_58_116 IACPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRKSKPPGRV-- 19 DOF17_32_90 LSCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKSS-KRSRT- 20 OBF_1_ ACRRYWTHGGTLRDVPVGGGTRKSA-KRSRT- 21 DOF18_29_87 LPCPRCNSTTTKFCYYNNYNLAQPRYYCKSCRRYWTQGGTLRDVPVGGGTRRSSSKRHR-- 22 DOF32_95_153 LKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTKNS-- 23 DOF7_89_147 LKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRRTKSN-- 24 DOF5_94_152 LKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKGKSG-- 25 DOF4_60_118 LNCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGSLRNVPVGGGFRRNKRSKSR-- 26 DOF22_17_75 LKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRRNNKKGKN-- 27 DOF2_29_87 LKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNATKRST-- 28 DOF1_33_91 LKCPRCDSPNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRK-SNKRSGS- 29 DOF3_50_108 LKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGRSRK--AKRSKTK 30 DOF21_41_99 LKCPRCNSPNTKFCYYNNYSLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRK--TKKSIKP 31 DOF19_40_99 LKCPRCDSVNTKFCYYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIG-GSTRNKNKPCSLQ 32 DOF30_27_85 LKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRESEFLSSGFSSLSALGLGLPHQ-- 33 DOF27_24_82 RVCPRCDSDNTKFCFYNNYSESQPRYFCKNCRRYWTHGGALRNIPVGGSCRKPKRLKVD-- 34 DOF25_21_79 RVCPRCYSDQTRFSYFNNNKKSQPRYKCKNCCRCWTHGGVLRNIPVTGICDKSNLPKID-- 35 DOF26_25_83 RVCARCDSDNTKFCYYNNYSEFQPRYFCKNCRRYWTHGGALRNVPIGGSS-RAKRTRINQ- 36 DOF14_25_83 RVCARCDSDNTKFCYYNNYCEFQPRYFCKNCRRYWTHGGALRNIPIGGSS-RAKRARVNQ- consensus/70% l.CPRCsSsNTKFCYYNNYslsQPRaFCKsCRRYWTcGGsLRNlPVGGGsR+spp.pss

12 +1ATG 5'UTR Dof 3'UTR T-DNA Isolamento del mutante inserzionale nel gene Dof DAG1 PCR su 29 HPs con le 2 coppie di primers Analisi su gel dei prodotti di PCR Blotting a sandwich Ibridazione sia con la sonda DAG1 che con la sonda T-DNA

13 + Sonda DAG1 Sonda T-DNA


Scaricare ppt "Gene Funzione Fenotipo??? mutante T-DNA REVERSE PCR-screening."

Presentazioni simili


Annunci Google