La presentazione è in caricamento. Aspetta per favore

La presentazione è in caricamento. Aspetta per favore

DETERMINAZIONE e DIFFERENZIAMENTO SESSUALE: IL GENE SRY Scamporlino Adriana a.a 2008/2009.

Presentazioni simili


Presentazione sul tema: "DETERMINAZIONE e DIFFERENZIAMENTO SESSUALE: IL GENE SRY Scamporlino Adriana a.a 2008/2009."— Transcript della presentazione:

1 DETERMINAZIONE e DIFFERENZIAMENTO SESSUALE: IL GENE SRY Scamporlino Adriana a.a 2008/2009

2 I cromosomi sessuali Il corredo cromosomico umano è costituito da 23 coppie di cromosomi omologhi 22 coppie di autosomi, morfologicamente uguali nei due sessi 1 coppia di cromosomi sessuali -sono definiti COPPIA perché, pur potendo essere diversi, durante la meiosi si appaiano comportandosi come cromosomi omologhi SESSO GENETICO o CROMOSOMICO -Sono definiti SESSUALI perché alle differenze che in essi si riscontrano tra individuo femminile e individuo maschile si associa il SESSO GENETICO o CROMOSOMICO di un individuo (sesso eterogamico) Il sesso maschile è portatore di una coppia eteromorfica di cromosomi sessuali (sesso eterogamico) sesso omogamico) Il sesso femminile è portatore di due cromosomi sessuali identici (sesso omogamico)

3 Sesso Genetico Si definisce SESSO GENETICO o CROMOSOMICO, il sesso determinato al momento della fecondazione I gameti, maschili e femminili, hanno un corredo cromosomico aploide (n), che comprende quindi un solo cromosoma sessuale Le cellule uova hanno tutte un cromosoma sessuale X Tra gli spermatozoi, alcuni hanno un cromosoma sessuale X, altri un cromosoma sessuale Y

4 In base alla fecondazione casuale della cellula uovo si potrà pertanto avere Poiché tutte le cellule di un organismo derivano dallo zigote ed hanno tutte una copia dei suoi cromosomi, IL SESSO GENETICO o CROMOSOMICO E UGUALE PER TUTTE LE CELLULE SOMATICHE, E FA PARTE DEL CARIOTIPO DELLINDIVIDUO. I cariotipi normali si indicano 46, XX sesso genetico femminile 46, XX sesso genetico maschile

5 SESSO GENETICO o CROMOSOMICO La determinazione del sesso è dato dalla fecondazione casuale di un ovulo con uno spermatozoo, che porta alla comparsa di cromosomi XX o XY. Come già detto questo è il SESSO GENETICO o CROMOSOMICO differenziamento del sesso Il differenziamento del sesso invece, è un processo che porta alla formazione di componenti caratteristici che distinguono il sesso femminile dal sesso maschile; in particolare si parla di: SESSO FENOTIPICO: SESSO FENOTIPICO: differenziamento dei genitali esterni e dei caratteri sessuali secondari (che si sviluppano dalla pubertà in poi) SESSO GAMETICO: SESSO GAMETICO: differenziamento delle cellule germinali in gameti SESSO GONADICO: SESSO GONADICO: differenziamento delle gonadi SESSO GENITALE: SESSO GENITALE: differenziamento delle vie genitali e dei genitali esterni La normale catena di processi differenziativi porta dalla determinazione del sesso genetico, al differenziamento del sesso gonadico, del sesso genitale e quindi del sesso gametico e del sesso fenotipico, in modo che tutti questo accordino con il sesso genetico dellindividuo.

6 Alla fine degli anni 50 non era ancora chiaro se la mascolinità fosse legata alla: presenza del cromosoma Y mancanza di una coppia di cromosomi X. Analogamente, non si sapeva se la femminilità fosse dovuta alla: mancanza del cromosoma Y presenza di due cromosomi X

7 Tale dilemma venne risolto analizzando: Sindrome di Klinefelter (cariotipo 47, XXY trisomia): gli individui affetti si presentano fenotipicamente maschi Sindrome di Turner (cariotipo 45, X0 monosomia): gli individui affetti si presentano fenotipicamente femmine. lassenza di un cromosoma Y determina la femminilità (e non il numero di X) la presenza di un cromosoma Y determina la mascolinità (e non il numero di X) 1) I cariotipi di pazienti con anomalie cromosomiche a carico dei cromosomi sessuali, derivanti dalla non disgiunzione di questi durante la meiosi 2) Il genoma degli pseudoermafroditi, cioè individui con sesso genetico diverso dal sesso gonadico Pseudoermafroditi maschili (individui con S.G. XY, S.F. ) possiedono un cromosoma Y mancante di una piccola regione. Pseudoermafroditi femminili (individui con S.G. XX, S.F. ) possiedono una piccola porzione del cromosoma Y traslocata su un cromosoma X CONCLUSIONE TDF fattore di determinazione testicolare il cromosoma Y deve contenere informazioni per la produzione di qualcosa, definita TDF, cioè fattore di determinazione testicolare, che serve per indirizzare attivamente il differenziamento del sesso gonadico maschile.

8 Dallanalisi comparata -delle sequenze di Y traslocate in un cromosoma X degli pseudoermafroditi femminili - delle sequenze di Y assenti negli pseudoermafroditi maschili si identificò il gene responsabile del TDF (= fattore di determinazione sessuale) Tale gene venne denominatoSRY regione sessuale del cromosoma Y) (= regione sessuale del cromosoma Y)

9 FONTE PRINCIPALE UTILIZZATA: National Center for biotechnology Information

10

11 Motore di ricerca coordinato da NCBI, che permette una ricerca contemporanea su molteplici database biomedici contenenti informazioni di tipo differente. SRY

12 Numero articoli correlati a SRY nei vari database

13 Specie interessata I geni indicati con tutte le lettere maiuscole sono di norma geni umani

14 TAVOLA DEI CONTENUTI DI ENTREZ GENE SU SRY 1) SOMMARIO RIASSUNTIVO 3) SEQUENZA NUCLEOTIDICA, TRASCRITTI E PRODOTTI 2) CONTESTO GENOMICO 4) BIBLIOGRAFIA

15 1) SOMMARIO RIASSUNTIVO Numero identificativo del gene SRY per Entrez-Gene Data ultimo aggiornamento (molto recente) Nome e simbolo ufficiale forniti da HGNC Identificativo di SRY per HGNC Altre fonti Gene della II classe, che codifica per proteine Questo gene privo di introni codifica un fattore di trascrizione che è membro della famiglia delle (HMG)-box DNA-binding protein. Questa proteina è il fattore di determinazione testicolare (TDF), che inizia la determinazione sessuale maschile. Mutazioni in questo gene danno origine a individui femminili XY con disgenesi gonadica (sindrome di Swyer); traslocazioni di parte del cromosoma Y contenete questo gene sul cromosoma X causa incividui maschili XX

16 HGNC: Human Gene Nomenclature Committee Per tutti i geni umani consciuti, HGNC approva un nome e un simbolo (breve forma abbreviata). Tutti i simboli approvati sono aggiunti al database di HGNC. Ogni simbolo è unico e si assicura che ogni ad ogni gene sia dato solo un simbolo approvato. Questo è necessario per provvedere un unica identificazione per il gene e un facilitato recupero elettronico di dati.

17 ENSG (Ensembl ID) Il progetto Ensembl produce database genomici si vertebrati e altre specie eucariotiche, e rende disponibili queste informazioni liberamente online (HPRD ID) HPRD rappresenta una piattaforma centralizzata per rappresentare visiva,emte e integrare informazioni riguardanti larchitettura di domini proteici, modificazioni post traduzionali, reti di interazioni e assiociazione a malattie per ogni proteina umana. Tutte le informazioni sono state estratte dalla bibliografia da esperti biologisti che leggono, interpretano e analizzano I dati pubblicati (OMIM ID) OMIM è un comprensivo, autoritario e preciso compendio sui geni umani e il fenotipo genetico. Contiene informazioni su tutte I conosciuti disordini mendeliani di più di geni e si focalizza sulla relazione tra fenotipo e genotipo. E quotidianamente aggiornato e contiene numerosi link ad altre risorse genetiche

18 La raccolta di Reference Sequence (RefSeq) mira a fornire un comprensivo, integrato, non ridondante e ben annotato set di sequenze, comprendendo DNA genomico, trascritti e proteine

19 2) CONTESTO GENOMICO Y:cromosoma Y:cromosoma p: braccio corto p: braccio corto 1: regione 1: regione 1:banda 1:banda.3:sotto banda.3:sotto banda Come si indica la localizzazione di un gene nel cromosoma ?? 1) Numero o lettera corrispondente al cromosoma q p 2) In ogni cromosoma si distingue un braccio lungo (q) e un braccio corto (p) regioni 3) Ogni braccio è suddiviso in regioni, numerate progressivamente a partire dal centromero bande 4) Ogni regione è suddivisa in bande, che si indicano con un numero unito al numero della regione, ma da leggere separatamente sottobande 5) Ogni banda è suddivisa in sottobande; ogni sottobanda in sotto- sottobanda, e così via. La numerazione dalla sottobanda in poi è separata dalle precedenti da un punto, e si numera senpre a partire dal centromero center 6) Il centromero è designato cen, e il telomero ter. Proximaldistal 7) Proximal individua la regione più vicina al centrometo; distal insica la porzione più distante dal centromero ma più vicina al telomero Basi che individuano gli estremi della porzione di DNA visualizzata, numerate a partire dal centromero Altri geni in prossimità si SRY N.B.: le freccie accanto a ciascun gene indica la direzione della trascrizione

20 Map Viewer permette di visualizzare e cercare il genoma completo di un organismo, visualizzare la mappa cromosomica, e ingrandire progressivamente in maggiori livelli di dettaglio, fino alla sequenza di una regione interessata.

21 La collocazione del gene (in celeste) a sinistra della linea e la freccia rivolta verso lalto, indicano lorientamento – del gene, che corrisponde alla direzione di trascrizione

22 STRUTTURA NUCLEOTIDE DNA

23 DOPPIA ELICA DI DNA I due filamenti decorrono in posizione anti parallela

24 TRASCRIZIONE DNA SINTESI DI UN RNA Lenzima RNApolimerasi aggiunge nucleotidi allestremità 3 del polimero in crescita. Ne consegue che una molecola di RNA si allunga in direzione 5 3

25 3) SEQUENZA NUCLEOTIDICA, TRASCRITTI E PRODOTTI

26 SEQUENZA NUCLEOTIDICA IN FORMATO FASTA >ref|NC_ |NC_000024: Homo sapiens chromosome Y, reference assembly, complete sequence TGAAATGAATAAGGCCTTTATTAGCCAGAGAAAAGAAAACAATATTGAAACTAAACATAAGAAAGTGAGGGCTGTAAGTTATC GTAAAAAGGAGCATCTAGGTAGGTCTTTGTAGCCAATGTTACCCGATTGTCCTACAGCTTTGTCCAGTGGCTGTAGCGGTCCC GTTGCTGCGGTGAGCTGGCTGCGTTGATGGGCGGTAAGTGGCCTAGCTGGTGCTCCATTCTTGAGTGTGTGGCTTTCGTACA GTCATCCCTGTACAACCTGTTGTCCAGTTGCACTTCGCTGCAGAGTACCGAAGCGGGATCTGCGGGAAGCAAACTGCAATT CTTCGGCAGCATCTTCGCCTTCCGACGAGGTCGATACTTATAATTCGGGTATTTCTCTCTGTGCATGGCCTGTAATTTCTGTGC CTCCTGGAAGAATGGCCATTTTTCGGCTTCAGTAAGCATTTTCCACTGGTATCCCAGCTGCTTGCTGATCTCTGAGTTTCGCA TTCTGGGATTCTCTAGAGCCATCTTGCGCCTCTGATCGCGAGACCACACGATGAATGCGTTCATGGGTCGCTTCACTCTATCC TGGACGTTGCCTTTACTGTTTTCTCCCGTTTCACACTGATACTTAGAGTTACAGCTTTCAGTGCAAAGGAAGGAAGAGCTTCT CCGGAGAGCGGGAATATTCTCTTGCACAGCTGGACTGTAATCATCGCTGTTGAATACGCTTAACATAGCAGAAGCATATGATT GCATTGTCAAAAACAAGGAGAGTGCGACAAAATTGAAAGGTGCCAGAGTTCGAAACTTATTTTACTATCCAAAACTCACTTCT ACCAGATTCTTTGTTACGTTAACTTTTGTAATGAAACTTGCATTTCTCCGCCCTCAACACCCCCTCAAC Inizia con una singola linea descrittiva, distinguibile dalla sequenza per il simbolo < nella prima colonna È raccomandabile che tutte le linee di testo siano al massimo di 80 caratteri di lunghezza Le sequenza, nucleotidiche o amminoacidiche, rispettano la nomenclatura IUB/IUPAC per acidi nucleici e amminoacidi Formato FASTA Essendo lorientamento –, linizio della trascrizione inizia da qui Non segnato: sequenza nucleotidica del filamento trascritto Segnato: seq. Nucl. Filamento complementare invertito >ref|NC_ |NC_000024:c Homo sapiens chromosome Y, reference assembly, complete sequence GTTGAGGGGGTGTTGAGGGCGGAGAAATGCAAGTTTCATTACAAAAGTTAACGTAACAAAGAATCTGGTAGAAGTGAGTTTT GGATAGTAAAATAAGTTTCGAACTCTGGCACCTTTCAATTTTGTCGCACTCTCCTTGTTTTTGACAATGCAATCATATGCTTCTG CTATGTTAAGCGTATTCAACAGCGATGATTACAGTCCAGCTGTGCAAGAGAATATTCCCGCTCTCCGGAGAAGCTCTTCCTTCC TTTGCACTGAAAGCTGTAACTCTAAGTATCAGTGTGAAACGGGAGAAAACAGTAAAGGCAACGTCCAGGATAGAGTGAAGCG ACCCATGAACGCATTCATCGTGTGGTCTCGCGATCAGAGGCGCAAGATGGCTCTAGAGAATCCCAGAATGCGAAACTCAGAG ATCAGCAAGCAGCTGGGATACCAGTGGAAAATGCTTACTGAAGCCGAAAAATGGCCATTCTTCCAGGAGGCACAGAAATTAC AGGCCATGCACAGAGAGAAATACCCGAATTATAAGTATCGACCTCGTCGGAAGGCGAAGATGCTGCCGAAGAATTGCAGTTT GCTTCCCGCAGATCCCGCTTCGGTACTCTGCAGCGAAGTGCAACTGGACAACAGGTTGTACAGGGATGACTGTACGAAAGCC ACACACTCAAGAATGGAGCACCAGCTAGGCCACTTACCGCCCATCAACGCAGCCAGCTCACCGCAGCAACGGGACCGCTAC AGCCACTGGACAAAGCTGTAGGACAATCGGGTAACATTGGCTACAAAGACCTACCTAGATGCTCCTTTTTACGATAACTTACA GCCCTCACTTTCTTATGTTTAGTTTCAATATTGTTTTCTTTTCTCTGGCTAATAAAGGCCTTATTCATTTCA Corrispondente inizio della trascrizione nel filamento NON tradotto Corrisponde esattamente alla sequenza FASTA del trascritto di mRNA

27 SEQUENZA NUCLEOTIDICA IN FORMATO GENBANK PARTE I: intestazione LOCUS: contiene indicazione circa lunghezza, tipo di molecola e data di modificazione REFERENCE: contiene indicazioni di articoli e pubblicazioni riguardo il gene SRY, con informazioni su autori, titolo, giornale e link allarticolo disponibile su PubMed SRY è un gene lungo appena 897 coppie di basi

28 PARTE II: caratteristiche INFORMAZIONI CHE SINTETIZZANO LA LUNGHEZZA DELLA SEQUENZA, LA SPECIE, LA LOCALIZZAZIONE REGIONE DI INTERESSE BIOLOGICO IDENTIFICATO COME UN GENE A CUI E ASSEGNATO UN NOME. SONO PRESENTI I VARI IDENTIFICATIVI DEL GENE IN DIVERSI DATABASE INFORMAZIONI SUL TRASCRITTO DI mRNA, COMPRENDENTE LA CDS E LA 5UTR E LA 3UTR. CDS: REGIONE DEI NUCLEOTIDI CHE CORRISPONDONO CON LA SEQUENZA DI AMMINOACIDI NELLA CORRISPONDENTE PROTEINA. LA CDS PUO ESSERE COMPLETA, PARZIALE AL 5, PARZIALE AL 3 O SUL FILAMNETO COMPLEMENTARE -CDS COMPLETA E SCRITTA, COME IN QUESTO CASO COMDE n…m, CHE RAPPRESENTANO GLI ESTREMI DELLA CDS -PARZIALE AL 5, INDICATA CON : la CDS SI ESTENDE PARZIALEMENTE AL 3 -(n…m): la CDS SI ESTENDE DA n A m MA è LOCALIZZATA SUL FILAMENTO COMPLEMENTARE

29 PARTE III: sequenza Formato GENBANK Linizio della sequenza è evidenziato dalla parola ORIGIN La sequenza è disposta in righe in ciascuna delle quali si trovano 6 stringhe di 10 caratteri ciascuna Il termine della sequenza è evidenziato da una riga con solo //

30 SEQUENZA AMMINOACIDICA IN FORMATO FASTA >gi| |ref|NP_ | sex determining region Y [Homo sapiens] MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSR DQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKN CSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL SEQUENZA AMMINOACIDICA IN FORMATO GENPEPT Il gene SRY codifica per una proteina di appena 204 amminoacidi […]

31 Dallamminoacido in posione 59 allamminoacido 130 è presente un dominio noto come SOX-TCF_HMG-box. Questo dominio si lega al DNA Link per la CCDS (= Consensus coding sequence)

32 LA PROTEINA CODIFICATA DAL GENE SRY, CONTIENE UN DOMINO MOLTO CONSERVATO NOTO COME HIGH MOBILITY GROUP – box, E PER QUESTO RIENTRA NELLA SUPERFAMIGLIA DELLE HMG-box DNA- binding PROTEIN, ED IN PARTICOLARE IN UN GRUPPO DELLA I CLASSE NOTO COME SOX-TCF_HMG-box

33 SOX-TCF_HMG-box, I classe di membri della superfamiglia HMG-box di proteine che legano il DNA. Queste proteine contengono un singolo HMG box, e legano il solco minore del DNA in maniera altamente sequenza-specifica. I membri includono SRY e i suoi omologhi negli insetti e vertebrati, e fattori trascrizioni come TCF-1, -3, -4, e LEF-1. Sembrano legare il solco minore del DNA in una sequenza A/T C A A A G/C SOX-TCF_HMG-box

34 High Mobility Group (HMG)-box si trova in una grande varietà di proteine e fattori trascrizionali di cromosomi eucariotici. HGMs si legano al solco minore del DNA e sono classificati in base alla preferenza nel legare il DNA. -Due distinti gruppi filogenici di proteine della I Classe legano il DNA in una modalità sequenza-specifica, ed hanno un singolo HMG-box. Uno di questi due gruppi è il gruppo SOX-TCF che include fattori di trascrizione (TCF-1, -4, -4) e anche SRY e LEF-1 -La II (HMGB)e III classe (UBF)di proteine lega il DNA in maniera non sequenza-specifica e contengono due o piu domini HMG in tandem. La II classe include proteine cromosomiali non istoniche che legano e piegano il DNA; la III classe comprende fattori di trascrizione nucleolari e mitocondriali HMG-box superfamily

35 4) BIBLIOGRAFIA GeneRIF fornisce un semplice meccanismo che permette di reperire annotazioni funzionali sulla descrizione dei geni in Entrez Gene.Entrez Gene

36 SRY inibisce la trascrizione beta-catenina-mediata Beta-catenin è una subunità della proteina complessa caderina. Beta- catenin sono impegate come componenti integrali nella Wnt signaling pathway.Wnt signaling pathway The Wnt signaling pathway descrive una complessa rete di proteine molto ben note per il loro ruolo nellembriogenesi e ne cancro.signaling pathway Nello sviluppo dellovaio, R- spondin1 and Wnt4 agiscono attraverso la Wnt/beta-catenin- signaling pathway per regolare lespressione di ancora sconosiutu geni bersaglio e reprimere lo sviluppo testicolare Viceversa, SRY potrebbe essere necessario per prevenire lo sviluppo dellovaio inibendo la Wnt/beta-catenin signaling pathway. In particolare tutto suggerisce che tale inibizione avvenga a livello delle beta- catenin-mediated

37 Nuova intuizione nella regolazione di SRY attraverso lidentificazione di una sequenza conservata al 5 BACKGROUND BACKGROUND: SRY è il gene cruciale nelliniziazione della determinazione del sesso maschile in gran parte dei mammiferi, but come sia regolata la sua espressione non è ancora chiaro. In questo studio si è trovato un insolita sequenza al 5 di SRY, da DNA bovino e caprino RISULTATI RISULTATI: Identificati 4 intervalli di altra omologia al 5 di SRY comparando sequenze genomiche umane, bovine, suine, caprine e murine. Queste regioni conservate contendono un putatuvo sito per un gran numero di conosciute famiglie trascrizionali, include alcune impiegate nella determinazione sessuale CONCLUSIONI: potenziali importanti elementi di regolazione di SRY al terminale 5, in cui mutazione potrebbero essere alla base di XY inversione di sesso

38 La lunghezza totale della proteina di SRY è essenziale per legare il DNA Non solo il dominio HMG- box, ha unimportanza funzionale nellattività della DNA-binding protein derivante da SRY Studio di 3 mutanti Proteina solo con il dominio HGM-box Proteina senza il terminale amminico Proteina senza il terminale carbossilico Diminuzione funzionalità nel legare il DNA Funzionalità approssimativa mente mantenuta Importanta funzionale di tutta la proteina, ed in particolare del dominio HMG-box e del C-terminale

39 Ricapitoliamo… SRY E IL GENE DEL DIFFERENZIAMENTO GONADICO MASCHILE, SITUATO SUL BRACCIO CORTO DEL CROMOSOMA Y DELEZIONE DELLA PORZIONE DEL CROMOSOMA Y CONTENTETE SRY, O MUTAZIONI A SUO CARICO PORTANO A : DISGENESI GONADICA INDIVIDUI 46,XY FEMMINE TRASLOCAZIONE DELLA PORZIONE DEL CROMOSOMA Y CONTENTENTE SRY PORTA A INDIVIDUI 46,XX MASCHI NELLUOMO MUTAZIONI DEL GENE SRY NON SONO MAI STATE ASSOCIATE A DIFETTI IN TESSUTI DIVERSI DALLE GONADI SRY, SEMBRA NON AVERE ALCUNA FUNZIONE NEGLI ALTRI TESSUTI CHE PRESENTANO IL TRASCRITTO

40 UN SINGOLO ESONE LA CDS DEL TRASCRITTO DI SRY E COSTITUITA DA UN SINGOLO ESONE E NON VI SONO SITI DI SPLICING AL SUO INTERNO HIGH MOBILITY GROUP-box BINDING PROTEIN SRY CODIFICA PER UNA PROTEINA APPARTENENTE ALLE HIGH MOBILITY GROUP-box BINDING PROTEIN IN QUANTO PRESENTA UN DOMINIO DI CIRCA 70 AMMINOACIDI DENOMINATO HGM-box, ALTAMENTE CONSERVATA IN TUTTI I MAMMIFERI. LEGA IL DNA NEL SOLCO MINORE LA FUNZIONE DI SRY NELLA DETERMINAZIONE DEL SESSO E STRETTAMENTE LEGATA ALLA CAPACITA DELLA PROTEINA DI LEGARSI AL DNA TRAMITE IL SUO DOMINIO HGM-box MUTAZIONI NEL DOMINO HGM O NEL 5 DELLA CDS PROTEINA ALTERATA PERDITA FUNZIONALITA SPECIFICA NEL LEGARE IL DNA REVERSIONE DEL SESSO

41 MOLTI ALTRI GENI CONTENGONO IL DOMINIO HGM OLTRE SRY SOX SOX SOX= Sry-related HMG-bOX- containig gene SRY La fuzione del dominio HGM nel legare il DNA La presenza di segnali di localizzazione nucleare nel dominio HGM PROTEINA SRY PREFERIBILMENTE LOCALIZZATA NEL NUCLEO PROTEINE HMG, LE PROTEINE HMG, ISOLATE IN QUANTO COMPONENTI NON ISTONICI DEI NUCLEOSOMI, SONO ACCOMUANTE DALLA PRESENZA DI UN DOMINIO CONSERVATO CON IL DNA, CHIAMATO APPUNTO HMG-box SONO CAPACI INSTAURARE UN LEGAME SITO-SPECIFICO CON IL DNA LINEARE E UN LEGAME NON SITO-SPECIFICO NELLE STRUTTURE CURVE DEL DNA LEGANO E INDUCONO LA CURVATURA DEL DNA, POTENDO AGIRE COME: Fattori trascrizionali diretti Ruolo architettonico nella deformazione del DNA che può facilitare lavvicinamento di specifici fattori trascrizionali ai geni bersaglio

42 I FENOTIPI PIU COMUNI ASSOCIATI A MUTAZIONI A CARICO DI SRY SONO: DISGENESIA GONADICA, FEMMINE XY PARZIALE DISGENESIA GONADICA REVERSIONE DEL SESSO CON PARZIALE FUNZIONALITA OVARICA Sostituzione base missense non sense Delezione frameshift

43 Da un corretto differenziamento del sesso gonadico, guidato da SRY dipende poi il SESSO GENITALE differenziamento del SESSO GENITALE La relazione tra sesso gonadico e sesso genitale è regolata dalla : La dottrina di Jost DOTTRINA DI JOST SULLO SVILUPPO SESSUALE: in condizioni normali il sesso GENETICO determina il sesso GONADICO. Quando non ci sono gonadi o queste sono ovaie, il feto sviluppa spontaneamente il sesso FENOTIPICO femminile. Quando le gonadi sono testicoli, vengono prodotti due tipi di ormoni che dirigono lo sviluppo verso il sesso FENOTIPICO maschile in condizioni normali il sesso GENETICO determina il sesso GONADICO. Quando non ci sono gonadi o queste sono ovaie, il feto sviluppa spontaneamente il sesso FENOTIPICO femminile. Quando le gonadi sono testicoli, vengono prodotti due tipi di ormoni che dirigono lo sviluppo verso il sesso FENOTIPICO maschile

44 La dottrina di Jost è in accordo con 1) esperimenti di rimozione delle gonadi da embrioni sia femminili che maschili, in varie fasi di sviluppo embrionale. rimuovendo le gonadi da embrioni femmine NON succedeva niente, cioè il feto si sviluppava in una femmina del tutto normale, con un SESSO GENITALE femminile, come se le gonadi non avessero niente a che fare con la determinazione di tale fenotipo rimuovendo le gonadi da embrioni maschili in fasi precoci di sviluppo, i feti si differenziavano in femmine rimuovendo le gonadi da embrioni maschili in fasi più tardive, il feto sviluppava un SESSO GENITALE maschile Il tempo di castrazione delle gonadi maschili risulta quindi critico e deve avvenire prima che il testicolo cominci a secernere due ormoni specifici. 2) Sviluppo embrionale delle vie genitali, considerando che nellembrione inizialmente si sviluppano sia gli abbozzi delle vie genitali femminili (DOTTI DI MULLER), che gli abbozzi delle vie genitali maschili (DOTTI DI WOLFF) Quando non ci sono gonadi, o queste sono ovaie, i dotti di Wolff DEGENERANO SPONTANEAMENTE, e i dotti di Muller si DIFFERENZIANO SPONTANEAMENTE nelle vie genitali femminili. I risultati di tali evidenze portano quindi a due conclusioni: la natura realizza spontaneamente il fenotipo femminile, in quanto individui castrati di entrambi il sessi si sviluppano SEMPRE come femmine le gonadi maschili (testicoli) devono realizzare ATTIVAMENTE il fenotipo maschile, Sopprimendo il differenziamento SPONTANEO del fenotipo femminile

45 DUE DIVERSI ORMONI MASCOLINIZZANTI PER PRODURRE IL FENOTIPO MASCHILE Il testicolo, in particolare, deve produrre DUE DIVERSI ORMONI MASCOLINIZZANTI PER PRODURRE IL FENOTIPO MASCHILE, in quanto devono provvedere attivamente a due diversi eventi: salvare i dotti di Wolff dalla spontanea degenerazione, e indurli a differenziarsi nelle vie genitali maschili testosterone, ormone steroideo testosterone, ormone steroideo Indurre la degenerazione dei dotti di Muller, che procederebbero altrimenti alla spontanea differenziazione in vie genitali femminili fattore antimulleriano, ormone proteico Il testosternone oltre ad un effetto mascolinizzante diretto sulle vie genitali, ha inoltre un effetto indiretto sui genitali esterni. Esso infatti viene convertito da un enzima chiamato riduttasi in diidrotestosterone, il quale dirige il differenziamento dei genitali esterni (CARATTERI SESSUALI PRIMARI MASCHILI) gli ormoni mascolinizzanti sono 3: testosterone testosterone, per il differenziamento del SESSO GENITALE diidrotestosterone diidrotestosterone, per il differenziamento dei CARATTERI SESSUALI PRIMARI (GENITALI ESTERNI) fattore antimulleriano, fattore antimulleriano, per impedire lo spontaneo differenziamento delle vie genitali femminili


Scaricare ppt "DETERMINAZIONE e DIFFERENZIAMENTO SESSUALE: IL GENE SRY Scamporlino Adriana a.a 2008/2009."

Presentazioni simili


Annunci Google